KEGG   Rhodopseudomonas palustris BisA53: RPE_2747Help
Entry
RPE_2747          CDS       T00400                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpe  Rhodopseudomonas palustris BisA53
Brite
Enzymes [BR:rpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RPE_2747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3089123..3089791
Genome map
AA seq 222 aa AA seqDB search
MSDFSTARRNMVDGQIRPSSVTDWRIIDAMREVPRDAFVPANQRELAYLDLDIDVSGPGA
TRRCLLRPVVTARLLQAASLQLEENVLVVGCATGYVAALAAKLAGRVTATESENTLAAQA
QDILQRLGGFGNVEVQAAAAVEGAPASGPYDAIILNGATEIVPKPLYRQLRDGGRLVGIF
ALGQTPRAEFVTRSGDDFGHRALFDVTAPVLPGLQRPVEFVF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatttttctaccgcgcgccgcaacatggtcgacgggcagattcggccgagcagc
gtcaccgattggcggatcatcgatgcgatgcgggaggtgccgcgcgatgccttcgtgccc
gccaatcagcgcgagctggcttatctggacctggatatcgacgtcagcgggcctggcgcc
accaggcgctgcctgctccggccggtcgtcaccgcgcgactgctgcaggccgccagcctg
cagctcgaagaaaacgttctggtcgtggggtgcgccaccggctatgtcgcggcgcttgcc
gccaagctcgccggccgcgttaccgcgaccgaaagcgaaaacaccctggcagcgcaggcc
caggatatcctgcagcgactgggcggcttcggcaatgtcgaggttcaagccgccgccgcc
gtcgagggagcccctgccagcggtccctacgacgccatcatcctcaatggcgcgaccgag
atcgttcccaagccgctttatcggcagttgcgcgatggcggccgtctggtcgggatcttt
gccctcggccaaacgccgcgcgctgaattcgtcacccgctcgggcgatgatttcggccac
cgcgccctgttcgatgtcaccgcgccggtgctgccggggctgcagcgtccggtggagttc
gtcttctga

DBGET integrated database retrieval system