KEGG   Rhodopseudomonas palustris BisA53: RPE_2871Help
Entry
RPE_2871          CDS       T00400                                 

Definition
D-cysteine desulfhydrase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RPE_2871
Enzymes [BR:rpe01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     RPE_2871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3216145..3217152
Genome map
AA seq 335 aa AA seqDB search
MEPQLLSAFPRVSIAHTPTPFEFLERLSARLGGPAIWVKRDDCTGLAGGGNKVRKLEFLI
GAALESGADTVITAGAIQSNHARQTAAAAARLNLRSILVLTDTVGCRGPAYRNNGNLLID
RLLGADIHLVGGDVDTESVLESIADRERERGRSPFVIPVGGSNAPGVLGYVAGFFELHAQ
IQEQATVFDAIVLPTGSGGTQAGLILGAAFSGWCGAIIGISVGASAERQRMKIAKSLRSA
AALLDIEDSDSNRADILVDDRFVGPGYGEPAPETIDAIRIAAETEGLLLDPVYSGKAMAG
LIALIRAGRFRRDQNAVFLHTGGAQALSAYPEHFI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttggaaccacagttgctatcggctttcccccgggtgtccatcgcccatactccgacgcca
ttcgagttcttggaacgactttccgcccgactcggcggaccagcgatctgggtgaagcgc
gatgactgcaccgggcttgccggcggtggaaacaaggttcgtaagctcgaatttctgatc
ggcgccgcactcgagtccggggccgataccgtgattaccgcgggcgctattcagtccaat
cacgcgcgccagacggccgcggcggccgcgcgcctgaatttgcggtccatcctggtgctc
actgacacggtcggatgtcgcggccccgcgtatcgcaataacggcaatctgctgatcgac
aggcttctgggcgccgacatccatctggtcggcggcgatgtcgacactgagtctgttttg
gaaagcatcgccgatcgagaacgcgaaaggggcaggagccccttcgttattcccgtcggt
ggctcgaatgcaccgggagtgctcggttatgtcgccggcttcttcgaactgcacgcgcaa
atccaggaacaagccactgttttcgatgccattgtgctgccaaccggcagtggaggcacc
caggccggactgatcctcggtgctgccttctccggatggtgcggcgctatcatcggaatc
agcgtcggagcctcagccgaacgccagaggatgaaaatcgcgaagtcgctgcgatccgcc
gccgctctgctcgatattgaagactccgacagcaaccgggcggacatcctggtcgacgat
cgctttgtcggtcccggctacggcgaacctgcccccgagaccatagacgcgatccgcatc
gcggcggaaaccgaggggcttttgctggaccctgtctacagcggcaaagcgatggctggg
ctcatagcgctgatacgcgcgggtcggtttcggcgcgatcagaacgcggtgtttcttcac
accggcggtgcccaggcactcagcgcgtatccagaacacttcatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system