KEGG   Rhodopseudomonas palustris BisA53: RPE_2885Help
Entry
RPE_2885          CDS       T00400                                 

Gene name
mazG
Definition
nucleoside triphosphate pyrophosphohydrolase (EC:3.6.1.19)
Orthology
K04765  
ATP diphosphatase [EC:3.6.1.8]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rpe00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rpe00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3234724..3235548
Genome map
AA seq 274 aa AA seqDB search
MTPSRDITRLIEIMAALRTPGTGCPWDLEQNFATIAPFTIEEAYEVAEAIARGDLDDLRD
ELGDLLLQVAFHARMAEEAGHFAFGDVVEAITQKMIRRHPHVFIDPADRSDTASAQVSWH
RIKAEEKAERAARRAEPAAEPASLLADVKPGQPALTRAMELQRKASTVGFDWHDPRAVLA
KIREEIDEIEEALDHGDQAAISDETGDLMFALVNLARHVGADPEAALRGTNAKFERRFAY
IERALAAQGRDCRSASLAEMDALWNDAKRDGNGK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaccccttcccgcgacatcacccgtctcatcgaaatcatggccgcgctgcgcacgccc
ggcaccggttgcccgtgggatctggagcagaattttgcgaccatcgcgcccttcaccatc
gaggaggcctatgaggtcgccgaggcgatcgcgcgcggcgatctcgacgatctgcgcgac
gaattgggcgacctcttgctgcaggtggcattccacgcccggatggcggaggaagccggc
cactttgctttcggcgacgtggtcgaggcgatcacccaaaaaatgatccgccggcacccg
catgtcttcatcgatccggccgaccgcagcgacaccgccagcgcccaggtctcctggcac
cggatcaaggcggaggagaaggccgaacgtgccgcgcggcgcgccgagccagccgcggag
ccggcctcgctgctggccgacgtcaagcccggccagccggcgttgacccgcgccatggag
ctgcagcgaaaggcctcgaccgtcggcttcgactggcacgatccgcgcgcggtgctggcc
aaaatccgcgaagagatcgacgaaatcgaggaggcgctggaccatggcgatcaggccgcg
atcagcgacgaaaccggcgacctgatgttcgcgctggtcaacctcgcccgccacgtcggc
gccgacccggaggccgcgctgcgcggcaccaacgccaaattcgagcgccgcttcgcctat
atcgagcgggcgctggcggcgcaggggcgcgactgccgctccgcctcgctggctgagatg
gatgccttgtggaacgacgcgaagcgcgacggaaacggcaaatag

DBGET integrated database retrieval system