KEGG   Rhodopseudomonas palustris BisA53: RPE_2960Help
Entry
RPE_2960          CDS       T00400                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
rpe  Rhodopseudomonas palustris BisA53
Brite
Enzymes [BR:rpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     RPE_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3315326..3316393
Genome map
AA seq 355 aa AA seqDB search
MVAMQDEYERSMAYAEVALRQIRSLQQAAVPRNYEIWYVYASGHNADLNKVVNETLARNG
KLTESDLDQIYDAYLSHGRATDRIDKIGARVVSEIEDVMSLISEALGLSASFGANLNGAN
QKLSLAGDRDQVIAVVERLVASTREMQEANQTLESRLTNSKLEINHLQQNLEAIRAESLT
DPLTGLGNRKHFDRAVEDAVRRAYANGEPLALLMIDIDHFKIFNDTYGHLTGDQVLRLVG
QALKQTITGQDIMARYGGEEFAVVLPNTTLRHAIGVAENIRRTVTAKELKKKSTGEILGR
VTVSIGVSELKLDEDMDSMIERADSCLYTAKRIGRNRVVCETDREYLGNNEVQVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggttgcaatgcaggacgagtatgagcgctcgatggcttatgccgaggtagcgctgcgg
cagatcaggtcgctgcagcaggctgcggtgccgcgcaactacgagatttggtacgtctac
gccagcggccacaacgccgacctcaacaaggtcgtcaacgaaacgctggcgcgcaacggc
aagctcaccgaatccgatctcgaccagatctacgacgcctatctctcgcacggccgcgcc
accgaccggatcgacaagatcggcgcgcgcgtcgtcagcgagatcgaggacgtgatgtcg
ctgatcagcgaggcgctcggcctgtccgccagtttcggcgccaacctcaacggcgccaac
cagaagctgtcgctggccggcgatcgcgaccaggtcatcgccgtggtcgagcggctggtg
gcttcgacccgcgagatgcaagaggccaaccagacgctggagagccggctcaccaattcc
aagctcgagatcaaccatctgcagcagaacctcgaggcgatccgcgccgagagcctgacc
gacccgttgaccgggctcggcaaccgcaagcatttcgaccgcgcggtcgaagacgccgtc
cgtcgcgcttacgccaatggcgagccgctggcgctgctgatgatcgacatcgaccatttc
aagattttcaacgacacctacggccacctcaccggcgatcaggtgctgcggctggtcggt
caggcgctgaaacagaccatcacgggccaggacatcatggcgcgctacggcggcgaggaa
ttcgcggtggtgctgcccaacacgacgctgcgccacgccatcggcgtagcggaaaacatc
cgccgcaccgtgaccgccaaggaactgaagaagaagtccaccggcgaaattctgggccgg
gtcaccgtctcgatcggcgtctcggagctgaagctcgacgaagacatggattcgatgatc
gaacgcgccgactcctgcctctataccgccaagcgcatcggccgcaaccgggtggtctgc
gagaccgaccgcgaatatctcggcaacaacgaggtgcaggtggcctga

DBGET integrated database retrieval system