KEGG   Rhodopseudomonas palustris BisA53: RPE_2960Help
Entry
RPE_2960          CDS       T00400                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rpe  Rhodopseudomonas palustris BisA53
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3315326..3316393
Genome map
AA seq 355 aa AA seqDB search
MVAMQDEYERSMAYAEVALRQIRSLQQAAVPRNYEIWYVYASGHNADLNKVVNETLARNG
KLTESDLDQIYDAYLSHGRATDRIDKIGARVVSEIEDVMSLISEALGLSASFGANLNGAN
QKLSLAGDRDQVIAVVERLVASTREMQEANQTLESRLTNSKLEINHLQQNLEAIRAESLT
DPLTGLGNRKHFDRAVEDAVRRAYANGEPLALLMIDIDHFKIFNDTYGHLTGDQVLRLVG
QALKQTITGQDIMARYGGEEFAVVLPNTTLRHAIGVAENIRRTVTAKELKKKSTGEILGR
VTVSIGVSELKLDEDMDSMIERADSCLYTAKRIGRNRVVCETDREYLGNNEVQVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggttgcaatgcaggacgagtatgagcgctcgatggcttatgccgaggtagcgctgcgg
cagatcaggtcgctgcagcaggctgcggtgccgcgcaactacgagatttggtacgtctac
gccagcggccacaacgccgacctcaacaaggtcgtcaacgaaacgctggcgcgcaacggc
aagctcaccgaatccgatctcgaccagatctacgacgcctatctctcgcacggccgcgcc
accgaccggatcgacaagatcggcgcgcgcgtcgtcagcgagatcgaggacgtgatgtcg
ctgatcagcgaggcgctcggcctgtccgccagtttcggcgccaacctcaacggcgccaac
cagaagctgtcgctggccggcgatcgcgaccaggtcatcgccgtggtcgagcggctggtg
gcttcgacccgcgagatgcaagaggccaaccagacgctggagagccggctcaccaattcc
aagctcgagatcaaccatctgcagcagaacctcgaggcgatccgcgccgagagcctgacc
gacccgttgaccgggctcggcaaccgcaagcatttcgaccgcgcggtcgaagacgccgtc
cgtcgcgcttacgccaatggcgagccgctggcgctgctgatgatcgacatcgaccatttc
aagattttcaacgacacctacggccacctcaccggcgatcaggtgctgcggctggtcggt
caggcgctgaaacagaccatcacgggccaggacatcatggcgcgctacggcggcgaggaa
ttcgcggtggtgctgcccaacacgacgctgcgccacgccatcggcgtagcggaaaacatc
cgccgcaccgtgaccgccaaggaactgaagaagaagtccaccggcgaaattctgggccgg
gtcaccgtctcgatcggcgtctcggagctgaagctcgacgaagacatggattcgatgatc
gaacgcgccgactcctgcctctataccgccaagcgcatcggccgcaaccgggtggtctgc
gagaccgaccgcgaatatctcggcaacaacgaggtgcaggtggcctga

DBGET integrated database retrieval system