KEGG   Rhodopseudomonas palustris BisA53: RPE_2974Help
Entry
RPE_2974          CDS       T00400                                 

Definition
redoxin domain-containing protein
Orthology
K03564  
peroxiredoxin Q/BCP [EC:1.11.1.15]
Organism
rpe  Rhodopseudomonas palustris BisA53
Brite
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     RPE_2974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3333074..3333784
Genome map
AA seq 236 aa AA seqDB search
MSKQIRKKSSKPAASQAAGSGAATVAEKSSKTRFGAKSPPATNAARGRKPTPLLDESSHK
PAAKPLSAATGKSPTSAPAVKPGGLSEGSKAPAFTLPRDGGDSVTLKSFAGRQLVIFFYP
RAGTPGCTREAIDFTRLLPEFEQAGVSVLGVSADAPAQQEKFRDKYQLKIPLASDEPHAM
LEAYGAWGEKSLYGKTFWGIVRTTVLIGADGRVKRVWRKVKVEGHADAVLAAAKER
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaaatccgcaagaaatcctccaaacccgcagcctcgcaagccgccggatcc
ggcgccgcgacggtcgcggaaaagtcatccaagacccgctttggcgccaaatcaccgccg
gccaccaacgccgctcgtggacgcaaaccgactccattgctcgacgaatcatcgcacaag
cccgcggcaaaaccgttaagcgccgcgaccggcaaatccccgacgtccgcgcccgctgtc
aaacccggcggcctgagcgagggcagcaaggcgcccgccttcacgctcccgcgcgatgga
ggagacagcgtcacgctcaagagcttcgccggacgccagttggtgattttcttttatccg
cgcgccggcacgccgggctgcacccgcgaggcgatcgatttcacgcggctgttgccggag
ttcgagcaagccggcgtcagcgtgctgggcgtctccgccgacgcgcccgcgcagcaggaa
aagtttcgtgacaagtaccagctcaaaatcccgctcgcctcggacgaacctcacgcaatg
ctggaagcctatggcgcctggggcgaaaaatcgctgtacggcaagacgttttggggaatt
gttcggaccacggttctgatcggcgccgacggccgggtgaagcgggtctggcgcaaggtc
aaggtcgagggccatgccgacgcggttctggcggcggcaaaagaacggtag

DBGET integrated database retrieval system