KEGG   Rhodopseudomonas palustris BisA53: RPE_3095Help
Entry
RPE_3095          CDS       T00400                                 

Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RPE_3095
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     RPE_3095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3459011..3460957
Genome map
AA seq 648 aa AA seqDB search
MTDHTDNKGVSRRTLLGTTAAAAGVGLAGGLALTNDGGGLIGTADAQTKASPTLPARPAI
QKAEVAPGELDEYYVFFSSGQSGELRIVGLPSMRELMRVPVFNRCSATGWGQTNESLKVL
TEGLLPESREFLKTRGGTYMNGDLHHPHLSFTEGTYDGRYAFMNDKANTRVARVRLDVMK
CDKIIQLPNQHTVHGLRVQKYPRTGYVFCNGEDRVPLINDGKILDKPKEYHAIFTAVDGD
SMKVAWQVMVDGNLDNVDADYQGKYAFATCYNSEEGVTAAEMTANEQDWVVIFNLRRIED
AVKKADFKETNGVPVIDGRKGSPYTRYVPVSNSPHGMNTAPDGIHVVANGKLSPTVTVMD
VRLFDQLFDDKIKPRDVVVAEPELGLGPLHTAYDGKGNCYTTLFIDSQICKWSIDRARRA
YKGEKIDPILDKLDVHYQPGHNHSSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPENDQ
LIDISGDKMKLVHDGPSFAEPHDATIVHRSKINPISIWDRADPMFSDAVRQAKADGVKLE
EESKMIRDGNKVRVYMTSQAPSFGLDHFQVKQGDQVTVHVTNIDSVEDLTHGFSIINYGI
NMEVAPQATASVSFSADKAGVYWYYCSWFCHAMHMEMKGRMFVEPKTA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacaccgacaacaagggcgtcagccggcgtacgctgctcggaaccacagcc
gccgccgcgggcgtcggccttgcaggtggcctcgcgctcaccaacgacggcgggggactg
atcggcaccgccgatgcgcagaccaaggcctcgccgacgctaccggcgcgcccggcgatc
cagaaggccgaggtcgcgcccggcgaactcgacgaatactacgtattcttctccagcggc
cagtccggcgaactccgcatcgtcggcctgccctcgatgcgcgaattgatgcgcgtgccg
gtgttcaaccgctgcagcgccaccggttggggccaaaccaatgaaagcctgaaggtcctg
accgaaggcctgctgccggaatcccgcgaattcctcaagactcgcggcggcacctatatg
aacggtgacctgcatcacccgcatctttcgttcaccgaaggcacctatgacggccgctac
gccttcatgaacgacaaggccaacacccgcgtcgcgcgcgtccggctcgacgtgatgaag
tgcgacaagatcatccaattgccgaaccagcacaccgtccacgggctgcgcgtgcagaaa
tatccgcgcaccggctatgtgttctgcaacggcgaggaccgcgtaccgctgatcaacgac
ggcaagatcctcgacaagccgaaggaatatcacgcaatcttcaccgcggtcgacggcgac
agcatgaaggtggcctggcaggtgatggtcgacggcaacctcgacaatgtcgacgccgac
taccagggcaaatacgccttcgcgacctgctacaattcggaggaaggcgtcaccgcggcg
gaaatgaccgccaacgagcaggactgggtggtgatcttcaacctgaggcggatcgaagac
gcagtgaagaaggcggatttcaaggagaccaacggcgtgccggtgatcgacggccgcaag
ggttcgccctacacccgttacgtgccggtctccaacagcccgcacggcatgaacaccgcg
cccgacggcattcatgtcgtggccaacggcaagctgtcgccgaccgtcacggtgatggac
gtgcggttgttcgatcaattgttcgacgacaagatcaagccgcgcgacgtcgtggtcgcc
gaacccgaactcgggctcggcccgttgcacaccgcctatgacggcaagggcaattgctac
accacgctgttcatcgatagccagatctgcaaatggagcatcgatcgggcacgccgcgcc
tacaagggcgagaagatcgacccgattctcgacaagctcgacgttcactaccagcccggc
cacaaccactcatcgatgggccagaccaaggaagccgacggaaagtggctgatctcgctc
aacaagttctccaaggaccggttcctcaatgtcggcccgctgaagcctgagaacgatcag
ctgatcgacatctccggcgacaagatgaagctggtgcatgacggcccgagctttgccgag
ccgcatgacgccaccatcgtgcatcgctccaagatcaacccgatctcgatctgggatcgc
gccgatccgatgttctcagacgccgtgaggcaggccaaggccgacggcgtgaagctggag
gaggagtccaagatgatccgcgacggcaacaaggtgcgagtgtacatgacctcgcaggcg
ccgtcgttcgggctcgatcacttccaggtcaaacagggcgaccaggtgacggtgcacgtc
accaatatcgactcggtcgaggacctcacccacggcttctcgatcatcaactacggcatc
aacatggaggttgcgccgcaggccaccgcctcggtcagcttctcagccgacaaagccggg
gtgtattggtactactgctcctggttctgtcacgccatgcacatggagatgaagggccgg
atgttcgtcgagccgaagacggcttga

DBGET integrated database retrieval system