KEGG   Rhodopseudomonas palustris BisA53: RPE_3442Help
Entry
RPE_3442          CDS       T00400                                 

Definition
deoxyribodipyrimidine photolyase (EC:4.1.99.3)
Orthology
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
rpe  Rhodopseudomonas palustris BisA53
Brite
Enzymes [BR:rpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.3  deoxyribodipyrimidine photo-lyase
     RPE_3442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3836219..3837670
Genome map
AA seq 483 aa AA seqDB search
MAISPPRPSLVWFRDDLRLSDHPALNAAASSGRPVLCLYVLDEQSPGGRPLGGAARWWLA
QSLRSLQQILSERGATLMLRRGAAAQVVAGLARETNAEVVYYNDIAMAPARTVAAELAAT
LADHGIAVHQHPGDLLAAPETIRTKEGRGLRVFTPFWKRVLSLGDPAKPLPAPTALGPPP
AAASDRLDDWALEPTAPDWAGGLRAAWQPGEAAAQRALTDFLTTGIAGYAGDRDRPDRPG
TSLLSPHLRFGEIGPRQIWHAARFAAAARPAIAGDVDKFLSELGWREFCRHLLFDHSDLA
TRNLQPAFDAFPWVEDPAGLRAWQRGLTGYPIVDAGMRQLWQTGVMHNRVRMVVASFLVK
HLLIDWRCGEQWFWDTLVDADAGSNPGNWQWVAGCGADAAPYFRVFNPILQGEKFDPDGA
YVRRFVPELARLPAALIHQPWTATPLELASAGVQLGHNYPEPIIEHRRGRERALAAYATV
RKT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccccgcctcgcccgtcgctggtctggtttcgcgatgacctgcggctctcc
gaccacccggcgctgaacgcggcagcgagcagcggccgacctgtgctctgcctctacgtg
ctcgacgagcaaagcccagggggccggccgttgggcggcgcggcgcgctggtggctggcg
caatcgctgcgcagcctgcagcagatcctcagcgaacgcggcgccacgcttatgctgcga
cgcggcgcggccgctcaggtcgtcgcggggctggcgcgcgagaccaacgccgaggtggta
tattacaatgacatcgccatggccccggcgcgcaccgtcgccgctgaactggcagcgacg
ctcgccgaccatggcatcgccgtccaccaacaccctggcgatctgctggcggcgcccgag
accatccgcaccaaggagggtcgcggcctcagagtgttcacaccattctggaagcgcgtg
ctgtcgctcggcgatccggcaaagccgctccccgccccgaccgcgctcggccccccgccc
gcggcggccagcgatcggctcgacgattgggcactggaaccgaccgcgccggactgggcg
ggcggtctgcgcgcagcctggcaaccgggcgaagcagcggcgcagcgggcgttgacggac
ttcctcaccaccgggatcgcgggctacgccggcgatcgcgaccgccccgaccgacccggc
acttcgttgctgtcgccgcatttgcggttcggcgaaatcggcccgcgccagatttggcac
gcggcgcggtttgccgccgccgcacggcccgcgatcgccggggacgtcgacaagtttctc
agcgaactcggctggcgcgaattctgccggcaccttttgttcgatcattccgacctcgcc
acccgcaatctgcagccggcgttcgacgccttcccgtgggtcgaagatccggccgggctg
cgcgcctggcagcgcgggctcaccggctatccgatcgtcgacgccggaatgcggcaactg
tggcagaccggggtgatgcacaaccgggtgcggatggtagtggcctcgttcctggtcaag
catttgctgatcgactggcgctgcggcgagcaatggttctgggacacgctggtcgatgcc
gacgccggcagtaacccgggcaattggcaatgggtcgccggctgcggcgccgacgccgcg
ccctatttccgggtgttcaatccgatcctgcagggcgaaaaattcgatcccgacggcgct
tacgttcgccgcttcgtgcccgaactggcgcggctgccggcggccttgatccatcagcca
tggaccgcgacgccgttggaactcgcttccgccggcgttcagttggggcacaactatccc
gaaccgatcatcgagcatcgacgcggccgcgaacgcgcgctcgcggcctacgcaactgtg
cgcaaaacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system