KEGG   Rhodopseudomonas palustris BisA53: RPE_3492Help
Entry
RPE_3492          CDS       T00400                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/subunit
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPE_3492
   00030 Pentose phosphate pathway
    RPE_3492
   00051 Fructose and mannose metabolism
    RPE_3492
   00052 Galactose metabolism
    RPE_3492
   00500 Starch and sucrose metabolism
    RPE_3492
   00520 Amino sugar and nucleotide sugar metabolism
    RPE_3492
  Nucleotide metabolism
   00230 Purine metabolism
    RPE_3492
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPE_3492
Enzymes [BR:rpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RPE_3492
    5.4.2.8  phosphomannomutase
     RPE_3492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3897220..3898818
Genome map
AA seq 532 aa AA seqDB search
MAINPIHSSHDLDIPEDPDARISFFPLRSDRYSAFPSPKSQLLPNTYAYESEPLVKPTGF
REYDARWLFGSEINLMGVQALGMGLGTLIAELGQKPEIVTGHDFRSYSASIKYALISGLM
AAGCTVHDIGLCMTPMAYFAQFELDVPCVAMVTASHNDNGWTGVKMGANRPLTFGPDEMT
RLKEIVLGAAFVNKPGGGYRFHQDFPARYIADLTKHAKLKRKLRVVVACGNGTAGAFAPQ
VLQAIGCEVIPLDTELDHSFPKYNPNPEDMEMLHAMRDAVLAHKADLAFGFDGDGDRCGV
VDDSGEEIFADKVGVMLARDMSAIHQDARFVVDVKSTGLFVTDPVLQAQGAQTEYWKTGH
SYMKRRTHESKALAGFEKSGHFFLNAPYGRGYDDGLVSAIAICEMLDRAPGKTMSDLKNA
LPKTWSSPTMSPHCADEAKYGVVDAVVAHFEAAQRDGEPVAGQPIRDLVTVNGVRVTCAD
GSWGLVRASSNKPELVVVVESPVSEERMHDMFATINAVLGSHPEVGEYNQTI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaatcccatacattcctcccacgacctcgacattcctgaagatcctgatgcg
cgaatttcgttctttcctctgcgttcggatcggtattcggcttttcccagcccgaaatct
caattgcttcccaacacctacgcctatgaatccgagccgctggtgaagccgaccggcttt
cgcgagtacgatgcgcgctggctgttcggctcggagatcaatctgatgggcgtgcaggcg
ctgggcatggggctcggcacgctgatcgccgaactgggccagaagccggagatcgtcacc
gggcacgatttccgcagctactcggcctcgatcaaatacgcgctgatttctgggctgatg
gccgcgggctgcacggtgcacgacatcgggctgtgcatgacgccgatggcctatttcgcg
cagttcgagctcgacgtgccttgcgtggcgatggtcaccgcctcgcacaacgacaatggc
tggaccggggtgaagatgggcgccaaccggccgctgacgtttgggccggacgagatgacg
cggctgaaggagatcgtgctcggcgcggccttcgtcaacaagccaggcggcggctatcgc
ttccaccaagattttccggcgcgctacatcgccgatctcaccaagcatgcgaagctgaag
cgcaagctgcgcgtggtggtggcctgcggcaacggcaccgctggcgcgttcgcgccgcag
gtgcttcaggcgatcggctgcgaggtgatcccgctcgataccgagctcgatcattcattc
ccaaaatacaatccgaatcccgaagacatggaaatgctgcacgcgatgcgcgacgcggtg
ctggcgcacaaggcggacctcgcctttggcttcgacggcgacggcgaccgctgcggcgtg
gtcgacgacagcggcgaggagatttttgccgacaaggtcggcgtgatgctggcgcgcgac
atgtcggcgattcaccaggacgcgcgcttcgtggtcgacgtgaagtcgaccgggctgttc
gtcaccgacccggtgctgcaggcgcaaggcgcgcagaccgaatattggaagaccggccat
tcctacatgaagcgccgcacccatgaatcgaaggcgctcgccggcttcgagaaatccggg
catttctttctcaacgcgccgtacggccgcggctatgacgacggcctggtctcggcgatc
gcgatctgcgagatgctcgaccgcgcccccggcaagaccatgtcggacctgaagaacgcg
ctgcccaaaacctggtcgtcgccgacgatgtcgccgcattgcgccgacgaggccaaatac
ggcgtggtcgacgccgtggtcgcgcattttgaggcggcgcagcgcgacggcgagcccgtc
gcaggccaaccgatccgcgacctcgtcacggtcaacggcgtgcgcgtcacctgcgccgac
ggcagttggggcctggtgcgggcctcgtcgaacaagcccgaactggtcgtggtggtggag
agcccggtgtcggaagagcgcatgcacgacatgttcgccacgatcaacgccgtgctgggc
agccatcccgaggtcggcgaatacaatcagacaatctag

DBGET integrated database retrieval system