KEGG   Rhodopseudomonas palustris BisA53: RPE_3644Help
Entry
RPE_3644          CDS       T00400                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPE_3644
Enzymes [BR:rpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RPE_3644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4065633..4067762)
Genome map
AA seq 709 aa AA seqDB search
MNSIQQLASRYGIATRYLDARGDMVTVDEHVLLKLLIAMGVVRPDGEVNETEQPAAVLPS
ALVVRPVSGQISVDLAGDLAVNRIAWQVNLEDGQCRRGESPLARQSKGSAPQLILSDMPY
GYHELLLETLDARTRLIVTPGRCWLPQTIARGGRSFGISLQLYLLRSARNWGIGDFGDLA
QFAQVAAGHGCDIVGVNPLHQMFPDDPEQASPYSPASRRFLNVLYIDVWAIPEWPRAAHV
RASIEPPAFNDELQRCRSASHVDYASVSRLKLQVLRLIHAEFRTHAGQARIGEFEHFVKD
GAAGLHHASLFQALRDHFVASDPALASWRHWPEGFRSPDSQEVRKFARDHQQDVDFYDWL
QWIADRQLAEAHDTATRAGMRIGLYRDLAVGCDHAGSETWSSPSDYISATEVGAPPDVFN
PAGQNWGLPPFNPVALLRAGYRPFIELVRANMRHAGGLRIDHVMGLQRLYCIPNGLPPSQ
GAFINYPLDDLIGIVALESHRQQCLVVGEDLGTVPAGFRERMAEANILSYRVLFFEHDEQ
GDYHPPENYPRLAVAVAGNHDLATLRGWLTGVDIALKDRLGLYPSAAETAAQLALRDRQR
AAVLHRLGLPGGAPPIAAEAFSEAVHRFLGATQSVLALTQLDDLLDERDQVNVPATSTEH
PNWRRRYVEPIENLTDDHPAWRLIDMLAADRRSGAADTRGADMSAEQNV
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgatccagcagctcgcatcccgttacggcatcgcgacaagatacttggatgcg
cgcggcgacatggtgacggtcgacgagcatgtgctgctgaagctactgatcgccatgggc
gtggtgcggccggatggtgaggtcaacgaaaccgagcagcctgccgcggtgcttccgtca
gcgctggttgtccgcccggtgagtggccaaatttccgtcgatctggccggcgatctcgcg
gtcaatcgcatcgcctggcaggtgaatttggaagacggccaatgtcgtcgcggggagagc
ccgcttgcgcgccaatccaaaggttcggcgccacagctgatcctgtccgatatgccgtat
ggctatcacgaactgctgttggaaacgctggacgcgcggacccgtctgatcgtgacacca
ggccgctgctggctgccgcagaccatcgcgcgaggcggtcgatctttcggaatttcgctg
caactctatctgctgcgctcggcccgcaattggggcatcggcgacttcggtgatctggcg
cagtttgcgcaagtcgcggccggccacggctgcgacattgtcggcgtcaatccgctgcat
cagatgtttccggatgatcccgagcaagccagcccgtattcgccggcgagccgccgcttc
ttgaacgtgctgtatatcgatgtgtgggccatccctgaatggccgcgcgcggcgcacgtg
cgcgcctcgatcgagccgccggctttcaacgacgagctgcagcgctgtcggtccgcatcg
cacgtcgattatgccagcgtcagccggctgaaactgcaagtgttgcggctgatccatgcc
gagtttcgaacccatgccggccaggcgcggatcggcgaattcgagcacttcgtcaaggac
ggcgcggctggcctgcaccatgcgtcgctgtttcaggcgctgcgcgatcatttcgtcgca
agcgatccggcgctggcttcgtggcgacactggcccgaggggtttcggtctcccgactcc
caggaagttcggaagtttgcccgcgaccatcagcaggatgtcgacttctacgactggctg
caatggatcgcggatcggcaattggccgaggcccatgatacagcgacgcgcgcgggcatg
cgcatcgggctgtatcgcgacctcgccgtcggatgcgaccacgccggatcggaaacctgg
tcgagcccctcggattatatcagcgccactgaagtcggcgcgccgccggacgtcttcaat
ccggcgggtcagaactggggattgccgccgttcaacccggtggcgttgctgcgcgcaggc
taccgccctttcatcgagttggtgcgggccaacatgcgccatgccggcgggttgcggatc
gatcacgtgatggggctgcagcggctgtattgcattcccaacggtctgccgccgtcgcag
ggcgccttcatcaactatccgctcgacgacctgatcggcattgtcgccttggaaagccac
cggcagcagtgcctcgtggtcggcgaggatctggggacggtgccggccggatttcgcgag
cggatggcggaggccaatatcctgtcctaccgcgtcttgttcttcgagcatgacgagcag
ggcgactatcatccgccggaaaactacccgcggctcgccgtggcggttgccggcaatcac
gacctggcgacgctgcgcggttggctgacaggcgtcgatatcgcgttgaaggatcgcttg
ggattgtatccgtccgccgcggaaacggctgcgcagctcgcgttgcgcgatcggcagcgc
gccgcggtgttgcaccggcttgggttgccgggcggtgcgccgccgatcgcggcggaggcg
ttttccgaagcggtgcatcgcttcctcggcgccacccagtcggtgctggcgctgacccag
ctggacgatctgctcgacgagcgcgatcaggtcaacgtgcccgcgacatcgaccgagcac
ccgaactggcgccgacgatatgttgagccgatcgaaaacctcaccgacgaccatcccgca
tggcggctcattgacatgctcgcggccgaccgtcggtctggagcagcagatacccgggga
gctgatatgtcggctgaacagaatgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system