KEGG   Rhodopseudomonas palustris BisA53: RPE_3644Help
Entry
RPE_3644          CDS       T00400                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00500  Starch and sucrose metabolism
rpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPE_3644
Enzymes [BR:rpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RPE_3644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ABJ07574
JGI: RPE3644
UniProt: Q07KG0
Position
complement(4065633..4067762)
Genome map
AA seq 709 aa AA seqDB search
MNSIQQLASRYGIATRYLDARGDMVTVDEHVLLKLLIAMGVVRPDGEVNETEQPAAVLPS
ALVVRPVSGQISVDLAGDLAVNRIAWQVNLEDGQCRRGESPLARQSKGSAPQLILSDMPY
GYHELLLETLDARTRLIVTPGRCWLPQTIARGGRSFGISLQLYLLRSARNWGIGDFGDLA
QFAQVAAGHGCDIVGVNPLHQMFPDDPEQASPYSPASRRFLNVLYIDVWAIPEWPRAAHV
RASIEPPAFNDELQRCRSASHVDYASVSRLKLQVLRLIHAEFRTHAGQARIGEFEHFVKD
GAAGLHHASLFQALRDHFVASDPALASWRHWPEGFRSPDSQEVRKFARDHQQDVDFYDWL
QWIADRQLAEAHDTATRAGMRIGLYRDLAVGCDHAGSETWSSPSDYISATEVGAPPDVFN
PAGQNWGLPPFNPVALLRAGYRPFIELVRANMRHAGGLRIDHVMGLQRLYCIPNGLPPSQ
GAFINYPLDDLIGIVALESHRQQCLVVGEDLGTVPAGFRERMAEANILSYRVLFFEHDEQ
GDYHPPENYPRLAVAVAGNHDLATLRGWLTGVDIALKDRLGLYPSAAETAAQLALRDRQR
AAVLHRLGLPGGAPPIAAEAFSEAVHRFLGATQSVLALTQLDDLLDERDQVNVPATSTEH
PNWRRRYVEPIENLTDDHPAWRLIDMLAADRRSGAADTRGADMSAEQNV
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgatccagcagctcgcatcccgttacggcatcgcgacaagatacttggatgcg
cgcggcgacatggtgacggtcgacgagcatgtgctgctgaagctactgatcgccatgggc
gtggtgcggccggatggtgaggtcaacgaaaccgagcagcctgccgcggtgcttccgtca
gcgctggttgtccgcccggtgagtggccaaatttccgtcgatctggccggcgatctcgcg
gtcaatcgcatcgcctggcaggtgaatttggaagacggccaatgtcgtcgcggggagagc
ccgcttgcgcgccaatccaaaggttcggcgccacagctgatcctgtccgatatgccgtat
ggctatcacgaactgctgttggaaacgctggacgcgcggacccgtctgatcgtgacacca
ggccgctgctggctgccgcagaccatcgcgcgaggcggtcgatctttcggaatttcgctg
caactctatctgctgcgctcggcccgcaattggggcatcggcgacttcggtgatctggcg
cagtttgcgcaagtcgcggccggccacggctgcgacattgtcggcgtcaatccgctgcat
cagatgtttccggatgatcccgagcaagccagcccgtattcgccggcgagccgccgcttc
ttgaacgtgctgtatatcgatgtgtgggccatccctgaatggccgcgcgcggcgcacgtg
cgcgcctcgatcgagccgccggctttcaacgacgagctgcagcgctgtcggtccgcatcg
cacgtcgattatgccagcgtcagccggctgaaactgcaagtgttgcggctgatccatgcc
gagtttcgaacccatgccggccaggcgcggatcggcgaattcgagcacttcgtcaaggac
ggcgcggctggcctgcaccatgcgtcgctgtttcaggcgctgcgcgatcatttcgtcgca
agcgatccggcgctggcttcgtggcgacactggcccgaggggtttcggtctcccgactcc
caggaagttcggaagtttgcccgcgaccatcagcaggatgtcgacttctacgactggctg
caatggatcgcggatcggcaattggccgaggcccatgatacagcgacgcgcgcgggcatg
cgcatcgggctgtatcgcgacctcgccgtcggatgcgaccacgccggatcggaaacctgg
tcgagcccctcggattatatcagcgccactgaagtcggcgcgccgccggacgtcttcaat
ccggcgggtcagaactggggattgccgccgttcaacccggtggcgttgctgcgcgcaggc
taccgccctttcatcgagttggtgcgggccaacatgcgccatgccggcgggttgcggatc
gatcacgtgatggggctgcagcggctgtattgcattcccaacggtctgccgccgtcgcag
ggcgccttcatcaactatccgctcgacgacctgatcggcattgtcgccttggaaagccac
cggcagcagtgcctcgtggtcggcgaggatctggggacggtgccggccggatttcgcgag
cggatggcggaggccaatatcctgtcctaccgcgtcttgttcttcgagcatgacgagcag
ggcgactatcatccgccggaaaactacccgcggctcgccgtggcggttgccggcaatcac
gacctggcgacgctgcgcggttggctgacaggcgtcgatatcgcgttgaaggatcgcttg
ggattgtatccgtccgccgcggaaacggctgcgcagctcgcgttgcgcgatcggcagcgc
gccgcggtgttgcaccggcttgggttgccgggcggtgcgccgccgatcgcggcggaggcg
ttttccgaagcggtgcatcgcttcctcggcgccacccagtcggtgctggcgctgacccag
ctggacgatctgctcgacgagcgcgatcaggtcaacgtgcccgcgacatcgaccgagcac
ccgaactggcgccgacgatatgttgagccgatcgaaaacctcaccgacgaccatcccgca
tggcggctcattgacatgctcgcggccgaccgtcggtctggagcagcagatacccgggga
gctgatatgtcggctgaacagaatgtctga

DBGET integrated database retrieval system