KEGG   Rhodopseudomonas palustris BisA53: RPE_3692Help
Entry
RPE_3692          CDS       T00400                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RPE_3692
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPE_3692
   00620 Pyruvate metabolism
    RPE_3692
   00650 Butanoate metabolism
    RPE_3692
  Lipid metabolism
   00071 Fatty acid degradation
    RPE_3692
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPE_3692
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPE_3692
   00626 Naphthalene degradation
    RPE_3692
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPE_3692
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RPE_3692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4122190..4124904
Genome map
AA seq 904 aa AA seqDB search
MVRPLPDNQNGGFTVTLSAPSNSPLSNSALTDLDQLVARVKAAQLVFATYSQEKVDLIFR
SAALAASDARISLAQMATAETGMGVVEDKVIKNHFASEYIYNAYKDDKTCGIIEVNDEAG
IMVVAEPIGLICGIVPTTNPTSTAIFKALICLKTRNGIIFSPHPRAARSTNAAAKLVLDA
AVAAGAPADIIGWIDTPTLQLSDALMHHPDVNLILATGGPAMVKAAYSSGKPAIGVGAGN
TPVVIDETADIKRAVASILMSKTFDNGVVCASEQSIIVVDSVYDAVRERFASHGGYMLKP
AELDAVRAVLLVNGNVNVNIVGQSAARIAELAGISVPRDTKLLIGEVDSTGVAEPFAHEK
LSPTLAMYRRADYAQAVAAAVELVALGGIGHTSALYTDQDLQPERIADFGSRMKTARILI
NTPSSHGGLGDLYNFSLAPSLTLGCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKL
PKSIYFRRGATSEALKDLAGKKRALIVTDSFLFSKGYTDDVIRLLKKNGMEVETFYQVEA
DPTLTIIKKGVEIAHAFQPDVIVAFGGGSPMDAAKLIWVLYEHPDVQFEDLALRFMDIRK
RIYKFPKLGIKAELVAIPTTSGTGSEVTPFAVVTDDSTGVKYPIADYELTPSMAIVDANF
VMNLPKSLTAFGGIDAVVHSLEAYVSIMASEFTDGQALQALRLLKDHLPSAYANGAKDPV
AREKVHSGATIAGIAFANAFLGVCHSMAHKLGAAFHIPHGLSNALLICNVIRYNANDNPT
KQTAFSQYDRPKSRHRYGEIAIALGLDGVNTAARIDNLLEWLEGLKRELDIPASIQAAGV
PEAAFLAKLDELAVEAFDDQCTGANPRFPLLDELKAILLASYYGRPFSEEYVEDEAVATA
AAAE
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
ttggttcgccctcttcctgacaatcaaaatggcggtttcaccgtgaccctctctgccccg
tccaattcgcccctgtccaattcggccctgaccgacctcgaccagctggtcgcgcgcgtc
aaagcggcgcaattggtcttcgctacctattctcaggaaaaggtggacctgattttccgc
agcgccgcgctggccgcttccgacgcccggatctccctggcgcagatggccaccgcggaa
accgggatgggcgtcgtcgaagacaaggtgatcaaaaaccattttgcctcggaatacatc
tacaacgcctataaagacgacaagacctgcggcatcatcgaggtcaacgacgaagccggc
atcatggtcgtcgccgagccgatcgggctgatctgcggcatcgtgccgaccaccaacccg
acctccaccgcgatcttcaaggcgctgatctgcctgaaaacccgcaacggcatcatcttc
agcccgcacccgcgcgcggcgcgctcgaccaatgccgccgcaaaactggtgctggacgcc
gccgtcgcggccggcgcgcccgccgacatcatcggctggatcgacacgccgacgctgcag
ctgtccgacgcgctgatgcatcatcccgacgtcaatctgatcctggccaccggcggcccg
gcgatggtgaaggcggcctattcctccggcaagccggcgatcggcgtcggcgccggcaac
accccggtggtgatcgacgaaaccgccgacatcaagcgcgcggtggcctcgatcctgatg
tcgaaaaccttcgacaacggcgtggtctgcgcctcggagcaatcgatcatcgtcgtcgat
tccgtctacgacgccgtgcgcgagcgtttcgccagccatggcggctacatgctgaagccg
gcggaattggacgcggtgcgcgcggtgctgctggtgaacggcaacgtcaacgtcaacatc
gtcgggcaatccgccgcccgcatcgctgaactggccggcatctcggtgccgcgcgacacc
aaattgctgatcggcgaagtcgacagcaccggcgtcgccgaacctttcgcgcacgaaaag
ctgtcgccgacgctggcgatgtatcggcgggccgactacgcccaggcggtggcggcggcg
gtggaactggtggcgctcggcggcatcggccacacctcggcgctctacaccgaccaggac
cttcagccggagcgcatcgccgatttcggcagcaggatgaagactgcgcgcatccttatc
aacacgccgtcgtcgcatggcggcctcggcgatctgtacaatttcagcctcgcaccgtcg
ctgacgctcggctgcggatcgtggggcggcaactcgatctcagaaaatgtcgggccaaaa
cacttgatcaacaagaagaccgtcgccaagcgcgccgagaacatgctgtggcacaagctg
ccgaaatcgatttatttccgccgcggcgccaccagcgaagcgctgaaggatctcgccggc
aagaagcgcgcgctgatcgtcaccgacagttttctgttcagcaagggctacaccgacgac
gtcatccgccttctgaaaaagaacggcatggaggtggagaccttctaccaggtggaagcc
gaccccacgctcacgatcatcaaaaagggcgtcgagatcgcccatgccttccagcccgac
gtcatcgtggcgttcggcggcggttcgccgatggatgcggccaagctgatctgggtgctc
tacgagcatcccgacgtgcagttcgaggatctggcgctgcgcttcatggacatccgcaag
cgcatctacaaattcccgaagctcggcatcaaggccgaactggtggcgatccccaccacc
tcgggcaccggctcggaagtgacgccgttcgcggtggtcaccgacgactccaccggcgtc
aaatatccgatcgccgactacgagctgaccccgagcatggcgatcgtcgacgccaatttc
gtcatgaacctgccgaagtcgttgaccgcgttcggcggcatcgacgcggtggtgcattcg
ctggaagcctatgtctcgatcatggccagcgaattcaccgacggccaggcgctgcaggcg
ttgcggcttctgaaggatcatctgccctcggcctatgccaacggcgccaaggatccggtc
gcgcgggaaaaggtgcacagcggcgccaccatcgccggcatcgccttcgccaacgccttc
ctcggcgtctgccattcgatggcgcacaagctcggcgcggcgttccacatcccgcacggc
ctgtccaacgcgctgttgatctgcaacgtcatccgctacaacgccaacgacaatcccacc
aagcagaccgcgttctcgcaatacgaccggccgaaatcccgccaccgctacggcgagatc
gcgatcgcgctgggcctggacggcgtcaacaccgccgcccggatcgacaatctgctggag
tggctggaagggttgaagcgcgaattggacatcccggcgtcgatccaggccgccggcgtg
cccgaagctgccttcctggccaagctcgatgagctggcggtcgaagccttcgacgaccag
tgcaccggcgccaacccgcgcttcccgctgctggacgaattgaaagccattttgctcgcc
agctattacggccgtccgttcagcgaggagtacgttgaggacgaggccgtcgccacggcc
gccgcggcggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system