KEGG   Rhodopseudomonas palustris BisA53: RPE_3768Help
Entry
RPE_3768          CDS       T00400                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RPE_3768
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPE_3768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4208718..4209272)
Genome map
AA seq 184 aa AA seqDB search
MDSFELNKVVGAVLGTCLVLLLSNIAANAIFDPGKLEKRGYEIAIKEDAPAATAKDAPAP
AASEPIEKLLQTASAEKGASAAKKCASCHTFEKGGPNRVGPNLFGVVGRDRAVEPGFNYS
AAMKSKGGKWTFEELNAFIANPKGTVPGTAMSFAGVPKDGERADLIAYLRTMADNPLPVP
TASN
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggattcctttgaactgaacaaggtggtgggggccgtgctggggacctgcctggtgcta
ctgctgtcgaacattgccgcgaatgcgatcttcgacccgggcaagctcgagaaacggggc
tacgagattgccatcaaggaggacgccccggcggccacggccaaggatgcgccggcgcca
gccgcctccgagccgatcgaaaagctgctgcagaccgcctcggcggaaaagggcgcgtcg
gcggccaagaagtgcgcctcctgtcacaccttcgagaagggcggtccgaaccgcgtcggt
ccgaacctgttcggcgtggtcggtcgcgaccgcgccgtcgagccgggtttcaactactcc
gccgcgatgaagtcgaagggcggcaaatggacgtttgaggaactcaacgccttcatcgcc
aatccgaagggtacggttcccggcaccgcgatgagttttgccggcgttcccaaggacggc
gagagggccgatctgatcgcctatctgcgcacgatggccgacaatccgctgccggtgccg
acggcgtcgaactag

DBGET integrated database retrieval system