KEGG   Rhodopseudomonas palustris BisA53: RPE_3774Help
Entry
RPE_3774          CDS       T00400                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RPE_3774
Enzymes [BR:rpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RPE_3774
Exosome [BR:rpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPE_3774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4218719..4220221)
Genome map
AA seq 500 aa AA seqDB search
MSFVLAIDQGTTSSRAIVFRDDISIAAVAQQEFSQHFPASGWVEHEPEDIWSSTLATSRA
AIEQAGLKASDIAAIGITNQRETVVLWDRVTGQAIHRAIVWQDRRTSEICARLKSEGHEP
LITQKTGLIIDPYFSGTKIGWLLDQVPGARARAERGELLFGTVDCYLLWRLTGGKIHATD
ATNASRTLLFNIHTGQWDAELLALLNVPRSLLPEVKDSSADFGTSDQNLFGGSIAIRGIA
GDQQAATIGQACFAPGMMKSTYGTGCFALLNTGSTPVKSNNKLLTTIAYQLNGQRTYALE
GSIFVAGSAVQWLRDGLGIISHASETGPLADKSDSTQSVYLVPAFVGLGAPYWNPRLRGA
LFGLTRNTGPAELAHAALESVCYQTFDLWAAMRADWPDADEASIVLRVDGGMTASDWTMQ
RLADLLDAPVDRPMIQETTALGAAYLAGLSAGIFPEPQQFADNWRLQHRFKPSMSAATRA
RKLKGWAAAVRGLLATDEGE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgtgctggccatcgatcagggcactacctcctcgcgcgccatcgtgtttcgc
gacgacatttcgatcgcggcggtcgcgcagcaggaattttcgcagcatttcccggcctcg
ggctgggtcgagcacgagcccgaggacatctggagctcgacgctggcgaccagccgcgcc
gcgatcgagcaggccgggctcaaagccagtgacatcgccgcgatcggcatcaccaaccag
cgtgagaccgtggtgctgtgggaccgcgtcaccggccaggcgatccaccgcgccatcgtc
tggcaggaccgccgcacctccgagatttgcgcacggcttaaatccgaaggtcatgagccg
ctgatcacgcaaaagaccgggctgatcatcgatccgtatttctccggcaccaagatcggc
tggctcttggaccaggtgccgggcgcgcgcgcccgcgccgagcgcggcgaactcttgttc
ggcacggtggattgctatctgctgtggcggctcaccggcggcaaaatccatgccaccgac
gccaccaatgcgtcgcgcacgctgctgttcaatatccacaccggacagtgggacgccgaa
ttgctggcgctcttgaacgtgccgcgctcgctgctgccggaggtgaaagactcctccgcc
gatttcggcacgagcgaccaaaacctgttcggcggcagcatcgccattcgcggcatcgcc
ggcgatcagcaggccgccaccatcggccaggcctgctttgcgccgggcatgatgaagtcg
acctacggcaccggctgtttcgcactgctcaataccggatcgacgccggtgaagtccaac
aacaagctgcttaccaccatcgcctatcagctgaacggccagcgcacctacgcgctggaa
ggctcgatctttgtcgcgggctccgcggtgcaatggctgcgcgatgggctgggcatcatc
agccacgccagcgagaccggcccgctcgccgacaaatcggattccacccaaagcgtctat
ctggtgccggccttcgtcggcttaggggcgccgtactggaatccgcggctgcgcggcgcg
ctgttcgggctgacccgcaataccggcccggccgaactggcgcatgccgcgcttgagagc
gtctgctaccagacttttgacctgtgggcggcgatgcgcgccgattggccggacgccgac
gaagcctcgatcgtgctgcgcgtcgacggcggcatgaccgcgtcggactggaccatgcag
cggctcgcggatctcttggacgccccggtcgaccgcccgatgatccaggaaaccaccgcg
ctcggcgccgcctatctcgccggcctttccgccggcatttttccggagccgcagcagttc
gccgacaattggcgcctgcaacaccgcttcaagccgtcgatgagcgcggccacccgtgcg
cgaaagctaaagggctgggcagcggcggtgcgcgggctgctggcgacggacgagggggag
tag

DBGET integrated database retrieval system