KEGG   Rhodopseudomonas palustris BisA53: RPE_3774Help
Entry
RPE_3774          CDS       T00400                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rpe00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4218719..4220221)
Genome map
AA seq 500 aa AA seqDB search
MSFVLAIDQGTTSSRAIVFRDDISIAAVAQQEFSQHFPASGWVEHEPEDIWSSTLATSRA
AIEQAGLKASDIAAIGITNQRETVVLWDRVTGQAIHRAIVWQDRRTSEICARLKSEGHEP
LITQKTGLIIDPYFSGTKIGWLLDQVPGARARAERGELLFGTVDCYLLWRLTGGKIHATD
ATNASRTLLFNIHTGQWDAELLALLNVPRSLLPEVKDSSADFGTSDQNLFGGSIAIRGIA
GDQQAATIGQACFAPGMMKSTYGTGCFALLNTGSTPVKSNNKLLTTIAYQLNGQRTYALE
GSIFVAGSAVQWLRDGLGIISHASETGPLADKSDSTQSVYLVPAFVGLGAPYWNPRLRGA
LFGLTRNTGPAELAHAALESVCYQTFDLWAAMRADWPDADEASIVLRVDGGMTASDWTMQ
RLADLLDAPVDRPMIQETTALGAAYLAGLSAGIFPEPQQFADNWRLQHRFKPSMSAATRA
RKLKGWAAAVRGLLATDEGE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgtgctggccatcgatcagggcactacctcctcgcgcgccatcgtgtttcgc
gacgacatttcgatcgcggcggtcgcgcagcaggaattttcgcagcatttcccggcctcg
ggctgggtcgagcacgagcccgaggacatctggagctcgacgctggcgaccagccgcgcc
gcgatcgagcaggccgggctcaaagccagtgacatcgccgcgatcggcatcaccaaccag
cgtgagaccgtggtgctgtgggaccgcgtcaccggccaggcgatccaccgcgccatcgtc
tggcaggaccgccgcacctccgagatttgcgcacggcttaaatccgaaggtcatgagccg
ctgatcacgcaaaagaccgggctgatcatcgatccgtatttctccggcaccaagatcggc
tggctcttggaccaggtgccgggcgcgcgcgcccgcgccgagcgcggcgaactcttgttc
ggcacggtggattgctatctgctgtggcggctcaccggcggcaaaatccatgccaccgac
gccaccaatgcgtcgcgcacgctgctgttcaatatccacaccggacagtgggacgccgaa
ttgctggcgctcttgaacgtgccgcgctcgctgctgccggaggtgaaagactcctccgcc
gatttcggcacgagcgaccaaaacctgttcggcggcagcatcgccattcgcggcatcgcc
ggcgatcagcaggccgccaccatcggccaggcctgctttgcgccgggcatgatgaagtcg
acctacggcaccggctgtttcgcactgctcaataccggatcgacgccggtgaagtccaac
aacaagctgcttaccaccatcgcctatcagctgaacggccagcgcacctacgcgctggaa
ggctcgatctttgtcgcgggctccgcggtgcaatggctgcgcgatgggctgggcatcatc
agccacgccagcgagaccggcccgctcgccgacaaatcggattccacccaaagcgtctat
ctggtgccggccttcgtcggcttaggggcgccgtactggaatccgcggctgcgcggcgcg
ctgttcgggctgacccgcaataccggcccggccgaactggcgcatgccgcgcttgagagc
gtctgctaccagacttttgacctgtgggcggcgatgcgcgccgattggccggacgccgac
gaagcctcgatcgtgctgcgcgtcgacggcggcatgaccgcgtcggactggaccatgcag
cggctcgcggatctcttggacgccccggtcgaccgcccgatgatccaggaaaccaccgcg
ctcggcgccgcctatctcgccggcctttccgccggcatttttccggagccgcagcagttc
gccgacaattggcgcctgcaacaccgcttcaagccgtcgatgagcgcggccacccgtgcg
cgaaagctaaagggctgggcagcggcggtgcgcgggctgctggcgacggacgagggggag
tag

DBGET integrated database retrieval system