KEGG   Rhodopseudomonas palustris BisA53: RPE_4149Help
Entry
RPE_4149          CDS       T00400                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rpe00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4639513..4641054)
Genome map
AA seq 513 aa AA seqDB search
MSPVDAARPQLKIRQIHLDTGRENVAVISRHSKALRPEVFSGFSRVEIRRGNQSMLATLL
ITDDNAMVGPDDLGLAEPAFRRFGEAAGSLVSVTPASPPASLDAVRGKIQGRTLTAPEIE
AIVNDLARYRYSDMEIAAFLIGAARFMTSDELLALVSAMASVGTQLRWDRPVVVDKHCIG
GIPGNRTSMVLVPIVAAHGLTIPKTSSRAITSPAGTADTMEVLARVDVGVPEMKEIVAAC
NGCLIWGGHVNLSPADDILISVERPLCLDTREQMVASIMSKKLAAGSTHLLVDLPLGPSA
KVISPIDAMRLRKLFEFVGDHFGIAVETITTDGRQPIGNGIGPVLEAQDVMAVLGNDPKA
PADLREKSLRLAGHLLEYDPNLRGGSGYARARELLESGAALKQMQKIIDNQGPTNCRKDL
GTLTTDIVAPRDGVVTGIDNLQLNRLARTAGAPIDKGAGIKLFKKVGDRVEQGEPLYRIY
AFDPSEQELAVSAAEESSGYTVDGVHAFREQVL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctgtcgatgccgcccgcccgcaactgaaaatccgtcagatccatctcgatacc
ggccgcgagaacgtcgcggtgatttcgcggcactccaaggcgctgcggccggaagtgttt
tcgggtttcagccgggtggagatccgccgcggcaaccaatcgatgctggcgacgctgctg
atcaccgacgacaacgcgatggtcggccccgacgacctgggcctcgccgagccggcgttc
cggcgcttcggcgaggcagccggctcgctggtgtcggtgacgccagcgtcgccgccggcc
agcctcgacgcggtacgcggcaagatccagggccgcacgctgaccgcgcccgagatcgag
gcgatcgtcaacgatctggcgcgctatcgctattccgacatggagatcgccgcgttcctg
atcggcgccgcgcggttcatgacctcggatgaattgctggcgttggtgtcggcaatggcc
tcggtcggcacgcagctgcgctgggaccggccggtggtggtcgacaagcactgcatcggc
ggcattcccggcaaccgcacctcgatggtgctggtcccgatcgtcgccgcgcacgggctg
acgatccccaaaacctcgtcgcgcgcgatcacctcgccggccggcaccgcggataccatg
gaggtgctggcgcgggtcgatgtcggcgtgccggagatgaaggagatcgtcgccgcctgc
aacggctgtctgatctggggcggccacgtcaatctgtcgccggccgatgacattttgatc
tcggtggagcggccgctctgtctcgacacccgcgagcagatggtggcctcgatcatgtcg
aagaaactcgccgccggctccacgcatctgttggtcgatctgccgctcggcccgtcggcg
aaagtcatcagcccgatcgacgcgatgcggttgcgaaaactgttcgaattcgtcggcgat
catttcggcatcgcggtggaaaccatcaccaccgacggccgccagccgatcggcaacggc
atcggtccggtgctggaggcgcaggacgtcatggcggtgctcggcaatgatccgaaggcg
ccggcggatctgcgcgaaaaatcgctgcggctcgccggccatctcttggagtatgatccg
aatctgcgcggtggctccggctatgcccgcgcccgcgaacttttggaaagcggcgcggcg
ctgaagcagatgcagaagatcatcgacaatcaggggccgacgaactgccgcaaggatcta
ggcacattgacgaccgacatcgtcgcgccgcgcgacggcgtggtcactggaatcgacaat
ctgcagctcaaccgtctggcgcgcaccgccggcgcgccgatcgacaagggcgccggcatc
aaactgttcaagaaggtcggcgaccgggtcgagcagggcgagccgctatatcggatctac
gccttcgatccgtcggagcaggaattggcggtgagcgcggccgaggagagtagcggctac
accgtcgacggcgtgcatgcgttccgcgagcaggtgttgtga

DBGET integrated database retrieval system