KEGG   Rhodopseudomonas palustris BisA53: RPE_4256Help
Entry
RPE_4256          CDS       T00400                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:rpe00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:rpe00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4762109..4762642
Genome map
AA seq 177 aa AA seqDB search
MRLTPLDLDGAVLIDVDRIVDSRGHFARVFCIDELTAAGLDAGIVQASVSFNNKCGTLRG
LHWQAGAQAEAKYVRCTRGAIFDAIVDLRPQSPTYLRWVSIELSQDNQRTLYIPKGFAHG
FQTLCDDTEIFYQMTERFAPEAACGARFDDAAFGIVWPKTEQRIISDKDLGYPGFAL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgactccccttgatctcgatggagcggtgctgatcgacgtcgataggatcgtt
gattcgcgcggtcattttgcccgagtgttctgcatcgacgagttgacggcggccggtctc
gacgctggcatcgtccaggccagcgtgtcgttcaacaacaaatgcgggacattgcgcggc
ctgcattggcaggccggtgcgcaggccgaggcgaaatacgtccgctgcacgcgtggcgcg
atcttcgacgcaatcgtcgatcttcggccgcagtcgccgacctatttgcgatgggtgtcg
atcgaactgagccaggacaaccaacgcacgctctacatccccaagggttttgcgcacggc
tttcagacgctttgcgacgacacggagatcttctaccagatgacggagcggtttgcgccc
gaggcagcgtgcggggcgcgatttgacgatgcggcgttcggcattgtttggccgaagacc
gagcagcgaatcatctcagacaaggacctcggctatccggggttcgcgctatga

DBGET integrated database retrieval system