KEGG   Rhodopseudomonas palustris BisA53: RPE_4286Help
Entry
RPE_4286          CDS       T00400                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rpe00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4795428..4796267
Genome map
AA seq 279 aa AA seqDB search
MTSRCPSGPAISRDEASGLCASLTDLVIRAGLAILEIDRSGLGIQGKADGSPVTQADLAA
DRVIAAGLAALRPDIPVVSEESTGPTTRLEGSFFLIDPLDGTKEYIAGRDEFTVNLALIV
DGTPLLGIVSAPAIGLVWRGVIGAGAERLALAPDGRITETMAIHSRPFPVAGSSWIAAVS
RSHGDTRTEAFIDARPGARRITVGSAVKFGRIAEGAADIYPRLGTTCEWDIAAGHAVVTA
AGGAVTDSNGQPICFGIGRERFLVPEFIAWGDPSAAAAR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcgctgcccctctggcccggcgatctcgcgcgacgaggcgagcgggctttgc
gccagtctcaccgatctggtgattcgcgccggcctcgccatcctcgagatcgaccgaagc
gggctcggcattcaaggcaaggccgatggttcgccggtaacacaggcggatcttgcggcc
gaccgggtgatcgccgctgggctcgcggcgctgcggccggacattccggtggtatccgaa
gaaagtaccggcccgacgactcgcctggagggcagcttcttcctgatcgatccgctggac
ggcaccaaggaatacatcgccgggcgcgacgagttcaccgtgaatctggcgctgatcgtc
gacggcacgccgctgctcggcatcgtcagtgcaccggcgattgggctggtctggcgcggc
gtgatcggcgccggcgccgagcggttggcgctggcgccggacggacgcatcaccgagaca
atggcgatccattcccgccccttcccggtagcgggcagctcatggatcgccgcggtcagc
cgctcgcatggcgatacccgcaccgaagcgttcattgacgcccgccccggcgcccggcgc
atcacggtcggttcggcggtgaaattcgggcgcatcgcggaaggcgccgccgatatctat
ccccgtcttggcacgacctgtgaatgggacattgccgccggccacgcggtggtgacggcg
gcgggcggcgcggtgacggattccaacggccaaccgatctgcttcgggatcgggcgcgaa
cgtttcctggtgcccgaattcatcgcgtggggcgatccgtccgccgcagctgcgcgctag

DBGET integrated database retrieval system