KEGG   Rhodopseudomonas palustris BisA53: RPE_4419Help
Entry
RPE_4419          CDS       T00400                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00900  Terpenoid backbone biosynthesis
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPE_4419
Enzymes [BR:rpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RPE_4419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABJ08343
JGI: RPE4419
UniProt: Q07I91
Position
complement(4950199..4951095)
Genome map
AA seq 298 aa AA seqDB search
MTEVVTALSEQARAKVNLTLRVIGRRVDGYHELESVVVFADCADGLTLAPGQDLSLDASG
PRVTECGDNADNLVIKAARLLAELVPGLKTGGFSLDKQLPIAAGIGGGSADAAAALRLLA
RSNGIALDDPRLMEAAKRTGADVPVCVASASCIMGGIGEKLTPLPLPRLSAVMVNPRVGV
PTKDVFAALGLKNGQLNVGVTDVVAAPAWPDRDAPLGEWIAALSAGVNDLEAPAKQVQPV
VGEVIALLAACDGALLARMSGSGATCFAIFGSDAEAKAAAQAIQRAHPNWWVHAGTLS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagttgtgacggcgctgagcgagcaggcgcgcgccaaggtcaatctgacgctg
cgcgtgatcggccgcagggtcgatggctatcatgaactcgaaagcgtggtggtgttcgcc
gactgcgccgatggtttgacgctcgcgccgggccaagacctcagtctcgatgccagcggg
ccccgcgtcaccgaatgcggcgacaacgccgacaatctggtgatcaaggcggcgcggctg
ttggccgaattggtgcccgggttgaaaaccggcggcttttcgctcgacaagcaactgccg
atcgcggccgggatcggcggcggctcggccgacgcggccgcggcgctgcggctgctggcg
cgctccaatggaattgcgctcgacgatccccggttgatggaagcggcgaaacgcaccggc
gccgacgtgccggtctgcgtcgcttcagcgtcctgcatcatgggcggaatcggcgagaag
ctgacgccgctgccgttgccgcggctctcggcggtgatggtcaatccgcgcgtcggcgtc
cccaccaaggacgtgtttgccgcgcttggattgaaaaacggccagttgaacgtcggcgtc
accgacgtggtggccgcgccggcctggccggatcgcgacgcgccgcttggcgagtggatc
gccgcactgtccgccggcgtcaacgacctcgaagccccggccaagcaggtgcagccggtg
gtgggcgaggtgattgcgctactggcggcttgcgacggcgcgctgctggcgcgaatgtcc
ggatccggcgcgacctgttttgcgattttcggcagcgatgccgaggccaaggccgccgcg
caggcgatccagcgtgcgcacccgaactggtgggtgcatgcgggaaccctgagctag

DBGET integrated database retrieval system