KEGG   Rhodopseudomonas palustris BisA53: RPE_4618Help
Entry
RPE_4618          CDS       T00400                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPE_4618
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPE_4618
   00052 Galactose metabolism
    RPE_4618
   00500 Starch and sucrose metabolism
    RPE_4618
   00520 Amino sugar and nucleotide sugar metabolism
    RPE_4618
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPE_4618
   00524 Butirosin and neomycin biosynthesis
    RPE_4618
Enzymes [BR:rpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RPE_4618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5171281..5172249)
Genome map
AA seq 322 aa AA seqDB search
MTAGRIEQAVLLADIGGTNARFALLSGGEIGAVEHLRVSDYPTFAQAMAAYLQAHTANVM
LRASNLAVAGNVQNGRCVMTNSPWVIDAAELQAEFPIGSVRVINDFEAVAWSLPAIARLH
QVGDGAPVPGAPLFALGPGTGLGMAANVPLPHGRVIVPSEGGHATLAGINPREDAVIGVL
RRKVGHVSAERVLSGSGLQNLYDALIALDGLTLPPRAAPDITKAGVEGSCATCRETVDLF
CALLGSVAGNLALVLGAKGGVYIAGGIVPRMSEHLSNSEFRARFEDKGRFRDYLRAIPTY
LVLEKDVAFVGLREFTAVEGMS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgggcggatcgaacaggcggtgctgctggccgatatcggcggcaccaatgcc
cgcttcgcgctgctgtcgggcggcgagatcggcgctgtcgagcatctgcgtgtcagcgac
tatccgaccttcgcgcaagcgatggcggcctatctgcaggctcacaccgctaacgtcatg
ctgcgcgcgtcgaatctcgcagtcgccggcaatgtgcagaacggccgttgcgtgatgacc
aactcgccctgggtgatcgacgccgccgagctgcaggcggaatttcccatcggctcggtg
cgggtgatcaatgatttcgaggcggtggcatggtcgctgccggcgattgcccggctgcac
caggtcggcgacggcgcgccggtgcctggagcgccgttattcgcgctcggcccgggcacc
gggctcggcatggccgccaacgtgccgctgccgcatgggcgcgtgatcgtgccgagcgag
ggcggacacgccacgctcgccggcatcaatccgcgcgaggatgctgtgatcggcgtgctg
cgccgcaaggtgggccacgtctcggccgaacgcgtgctgtccggcagcggtctgcaaaat
ctctacgacgcgttgatcgcgctggacggcctgacgctgccgccgcgtgcggcaccggac
atcaccaaggccggggtcgagggcagttgcgcgacctgccgtgagacggtcgacctgttc
tgcgcgctgctcggcagcgtcgccggcaatctggcgctggtgctcggcgccaagggcggc
gtctacatcgccggcggcatcgtgcctcgcatgagcgaacacttgtcgaattcggaattt
cgcgcgcggttcgaggacaagggccggtttcgcgattatctgcgcgcgatcccgacctat
ctggtgctggaaaaggacgtggcctttgtcggcctgcgcgaattcaccgcggtcgagggc
atgagctga

DBGET integrated database retrieval system