KEGG   Rhodopseudomonas palustris BisA53: RPE_4759Help
Entry
RPE_4759          CDS       T00400                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPE_4759
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPE_4759
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RPE_4759
Enzymes [BR:rpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RPE_4759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5337433..5338854
Genome map
AA seq 473 aa AA seqDB search
MLPHYISTRGEAPKLGFCDVMLTGLARDGGLYVPEVWPQLSPDTIASFFGRPYWEVAVEV
IRPFVYGEITDAELGEMANEAYATFRHPAVVPLNQVSPSQFTLELFHGPTLAFKDVAMQL
LSRLMDHVLAKRQQRITIVVATSGDTGGAAVDAFAGRDNVDLVVLFPDGKISDVQRRMMT
TSAAGNVHALALEGNFDDCQAIVKGLFNHHRFRDQVSLSGVNSINWARIIAQVVYYFTSA
VALGAPRREVDFTVPTGNFGDIFAGYVAKKMGLPVRKLRIAANVNDILARTLKTGIHEVR
EVHATASPSMDIQVSSNFERLLFEASHRDAALVRALMASLGQSGRYVLPDAVLAAIRTEF
DAGRADEQETAAAIRTAWREAGDLVDPHTAVALAVADHDLADATVPNIVLSTAHAAKFPD
AVEAACGVRPELPLWLEGLMTKPEQVKVMPCDQSAIERYVLSVSRVAKQGATP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtgttgccgcactatatttcgacgcggggcgaggcccccaagctcggcttctgcgatgtc
atgctcactggtctcgcccgcgatggcgggctgtatgtgccggaggtgtggccgcagctt
tctcccgacaccatcgcctcctttttcgggcgtccctattgggaggtcgcggtcgaggtg
atccgaccgttcgtctatggcgagatcaccgacgccgaactcggtgagatggccaacgag
gcctatgccaccttccgccatcccgcggtggtgccgctcaatcaggtgagcccgagccag
ttcacgctggaattgttccacggcccgacgctggcgttcaaggacgtcgcgatgcagttg
ctgtcgcggctgatggaccatgtgctggcaaagcggcagcagcgcatcaccatcgtggtc
gcgacctccggcgacaccggcggcgccgcggtcgacgccttcgcaggccgcgacaatgtc
gacctggtcgtgctgtttccggacggcaaaatctccgacgtgcagcgccggatgatgacc
acgtcggcggccggcaacgttcacgcgctggcgctcgagggcaatttcgacgactgccag
gcgatcgtgaagggcctgttcaaccaccacagatttcgcgaccaggtgtcgctgtccggc
gtcaattcgatcaactgggcgcggatcatcgctcaggtggtgtactacttcacctcggcg
gtggcgctcggcgcgccgcgccgcgaggtcgacttcaccgtgccgaccggcaatttcggc
gacatttttgccggctatgtcgccaagaagatggggctgccggtgcgcaagctgcgcatc
gccgccaacgtcaacgacatcctggcgcgaacgctgaagaccggcatccacgaggtccgc
gaggtccacgccaccgcctcgccgtcgatggacatccaggtgtcctcgaatttcgaacgg
ctgttgttcgaggcaagtcaccgtgacgccgcgctggtacgcgcgttgatggcctcgctc
ggccagtccggccgctatgtgttgccggacgcggtgctggcggcgatccgaaccgaattc
gacgccggtcgcgccgacgagcaggaaactgcagccgcgatccgcactgcctggcgcgag
gccggcgatctggtcgacccgcataccgcggtggcgctggcggtggccgaccatgacctg
gccgacgccaccgttcccaacatcgtgctctcgaccgcgcatgcggccaagttccccgat
gcggtggaagccgcctgcggggtgcgccctgaacttccgctctggctggaaggactgatg
accaagcccgaacaggtgaaggtcatgccgtgcgaccagtcggcgatcgagcgctatgtg
ctctcggtgagccgggtggcaaaacagggagccacgccatga

DBGET integrated database retrieval system