KEGG   Ralstonia pickettii 12D: Rpic12D_0048Help
Entry
Rpic12D_0048      CDS       T00925                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpf01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rpf00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(52342..53271)
Genome map
AA seq 309 aa AA seqDB search
MTIIDLIGAAIGCGAQDDGCKDGPRVLLEAGALARLQTPDTQATLVHDIELATSAGHSRS
ARLAALPGVAGFSRALGDATAHSVHQGHVPVVIGGDHSCAIGTWSGVANALRPKGPLGLI
WIDAHLDSHTPQTSDSGAIHGMPLAALLGHGAAALTQIGDAAPKLLPEHVVVIGARSYEP
AERALLDLLGVRVIDAAEVARNGLRAVMADAIRQVKSGTAAFGVTLDLDAFDPAVAPGVG
TPETDGLTAQGMAQALAACARDARFAAFELVEYNPRHDKDGITAHLALDLLASVAGALHA
QRREYATAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgatctgatcggcgcggccatcggctgcggagcgcaagacgacggctgc
aaggacggcccgcgtgtgctgctcgaggccggcgcgctggcgcgattgcagacgccggac
acgcaggccacgctcgtacacgacatcgaactggccacgtcggccgggcacagccgctca
gcgcgcttggccgcgctcccgggcgttgccggtttctcgcgcgcgctcggtgacgcaacc
gcccacagcgtgcaccaggggcatgtgcccgtggtcatcggcggcgatcactcgtgcgcc
atcggcacgtggtccggcgtggcgaacgccttgcggccgaagggcccgctcggcctgatc
tggatcgatgcccatctcgacagccacacaccgcagaccagcgattccggcgccatccac
ggcatgccgctggcggcgctgctcggccacggtgcggcggccctcacgcagatcggcgat
gccgcgccgaagctgctgccggaacacgtcgtggtgatcggcgcgcgcagctacgagccc
gccgaacgcgcgttgctggatctgcttggcgtgcgcgtcatcgacgctgccgaagtggca
cgcaacggcctgcgcgccgtcatggccgacgccatccgccaggtcaaatcgggcacggcg
gcctttggcgtaacgctggatctggatgccttcgaccccgccgtcgcacccggcgtcggc
acgcctgaaacagacgggctcaccgcgcagggcatggcgcaagcacttgccgcgtgcgca
cgcgacgcacgtttcgccgcattcgaactcgtggaatacaacccgcgccacgacaaagac
gggatcacagcgcatctggccctggacctgctggccagcgtcgcaggcgcattgcacgcc
cagcgccgcgaatacgcgacggcggcttaa

DBGET integrated database retrieval system