KEGG   Ralstonia pickettii 12D: Rpic12D_0048Help
Entry
Rpic12D_0048      CDS       T00925                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00220  Arginine biosynthesis
rpf00330  Arginine and proline metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01130  Biosynthesis of antibiotics
rpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rpic12D_0048
   00330 Arginine and proline metabolism
    Rpic12D_0048
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rpic12D_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACS61360
JGI: Rpic12D_0048
UniProt: C6BK91
Position
1:complement(52342..53271)
Genome map
AA seq 309 aa AA seqDB search
MTIIDLIGAAIGCGAQDDGCKDGPRVLLEAGALARLQTPDTQATLVHDIELATSAGHSRS
ARLAALPGVAGFSRALGDATAHSVHQGHVPVVIGGDHSCAIGTWSGVANALRPKGPLGLI
WIDAHLDSHTPQTSDSGAIHGMPLAALLGHGAAALTQIGDAAPKLLPEHVVVIGARSYEP
AERALLDLLGVRVIDAAEVARNGLRAVMADAIRQVKSGTAAFGVTLDLDAFDPAVAPGVG
TPETDGLTAQGMAQALAACARDARFAAFELVEYNPRHDKDGITAHLALDLLASVAGALHA
QRREYATAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgatctgatcggcgcggccatcggctgcggagcgcaagacgacggctgc
aaggacggcccgcgtgtgctgctcgaggccggcgcgctggcgcgattgcagacgccggac
acgcaggccacgctcgtacacgacatcgaactggccacgtcggccgggcacagccgctca
gcgcgcttggccgcgctcccgggcgttgccggtttctcgcgcgcgctcggtgacgcaacc
gcccacagcgtgcaccaggggcatgtgcccgtggtcatcggcggcgatcactcgtgcgcc
atcggcacgtggtccggcgtggcgaacgccttgcggccgaagggcccgctcggcctgatc
tggatcgatgcccatctcgacagccacacaccgcagaccagcgattccggcgccatccac
ggcatgccgctggcggcgctgctcggccacggtgcggcggccctcacgcagatcggcgat
gccgcgccgaagctgctgccggaacacgtcgtggtgatcggcgcgcgcagctacgagccc
gccgaacgcgcgttgctggatctgcttggcgtgcgcgtcatcgacgctgccgaagtggca
cgcaacggcctgcgcgccgtcatggccgacgccatccgccaggtcaaatcgggcacggcg
gcctttggcgtaacgctggatctggatgccttcgaccccgccgtcgcacccggcgtcggc
acgcctgaaacagacgggctcaccgcgcagggcatggcgcaagcacttgccgcgtgcgca
cgcgacgcacgtttcgccgcattcgaactcgtggaatacaacccgcgccacgacaaagac
gggatcacagcgcatctggccctggacctgctggccagcgtcgcaggcgcattgcacgcc
cagcgccgcgaatacgcgacggcggcttaa

DBGET integrated database retrieval system