KEGG   Ralstonia pickettii 12D: Rpic12D_0169Help
Entry
Rpic12D_0169      CDS       T00925                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Rpic12D_0169
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rpic12D_0169
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Rpic12D_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(177857..178552)
Genome map
AA seq 231 aa AA seqDB search
MLFPTTVSPRRPRLQLHASGALRRHHVLMIIIAIAIAVIALLLPRTGHAATAGVAPTVQA
PVAAGACPASLNFRVKRLQDDAPQDLCQYAGRVVLVVNTASYCGYTHQYEGLEALYAKYR
DKGLTVLGFPSNDFQQEPGNSKQIADFCYNTYGVKFPMFSKTAVVGAVASPLYAWLATQT
GQPPKWNFHKYLLDRNGRVAAVFPSSVEPSDPALIKRIDALLAEPSTRSSR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgctatttcccaccaccgtttccccgcgtcgcccacgcctgcaattgcacgcgtcgggt
gcgctgcgtcggcaccatgtgctgatgatcatcattgcgattgccattgccgtcattgca
ttgctgctgccccgcacaggacatgccgccacggccggcgtcgcaccgaccgtgcaagcg
ccggttgccgcaggcgcatgccctgccagcctgaattttcgcgtcaagcgcctgcaggac
gacgcgccacaagacctgtgccagtacgccggccgcgtcgtgctggtcgtcaacaccgcc
agctattgcggctacacgcatcagtacgaagggctcgaagcgctgtacgcaaagtatcgc
gacaaggggctgacggtgctgggctttccgtccaatgactttcagcaggaacccggcaac
agcaagcagatcgccgacttttgctacaacacgtacggcgtgaaattcccgatgttctcg
aagacggccgtggttggcgcggttgcgtcgccgctgtatgcgtggctcgcgacgcagacg
ggccagccgcccaaatggaatttccacaagtacctgctagaccgcaatggccgcgtggca
gcagtattcccgagcagcgtcgaaccgagcgacccagcgctcatcaaacgcatcgacgca
ctgctggctgaaccatcgacccgctcgtcccgctga

DBGET integrated database retrieval system