KEGG   Ralstonia pickettii 12D: Rpic12D_0278Help
Entry
Rpic12D_0278      CDS       T00925                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rpf00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(287842..288711)
Genome map
AA seq 289 aa AA seqDB search
MSSAPVELRDCPAPAKLNLFLHVVGRRPDGYHLLQTVFQLIDWSDTLHFARRPDGRLVRT
TDIPGVHADDDLVIRAARLLQAETGCTYGVDIAIEKRLPMGGGLGGGSSDAATTLLALNR
LWGLDLPRTQLMAIGLKLGADVPFFVFGQNAFAEGIGEELTPVTLPPAAFVVIHPRVHVP
TPAIFSDEGLTRDTPLTIITDFPDQQIVFAYGRNDLQAVAERKYGEIARALVWLRQFSPL
ARMTGSGACVFAPFDNVEQAQAVADQVPSEWEGRCAAGLSQHPLARFAV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgcccccgtcgagctgcgtgattgccccgcgcccgccaagctcaatctcttc
ctgcatgtagtcggccgccggccagatggctaccacctgctgcaaaccgtcttccagttg
atcgactggagcgacacgctgcatttcgcgcgccgccccgacggccgcctcgtgcgcacc
accgacatccccggcgtgcacgccgatgacgaccttgtgatccgcgccgcgcgcctgctg
caagcggaaaccggctgcacctacggcgtcgacatcgcgatcgagaaacgcctgccgatg
ggcggtggccttggcggcggctcgtctgatgctgccaccacgctgcttgcgctcaatcgt
ctctggggccttgatctgccacgcacgcaactgatggcgatcggcctgaagctgggcgcc
gacgtgcccttcttcgtgttcggccagaacgccttcgccgaggggatcggcgaagaactc
acgccggtcacgctgccgccggctgccttcgtggtgattcacccacgcgtgcatgtgccg
acccctgcaattttttccgatgaagggttgacacgcgatacgccactcaccataattacg
gactttcctgaccaacaaattgttttcgcttacggtcgcaacgacctgcaagcggtggcg
gaaaggaaatacggcgaaatcgcccgagcacttgtctggctgcgtcagttcagccctctg
gcaagaatgaccggatccggcgcctgcgtatttgctccgttcgacaacgttgagcaggcg
caagcggtggcggatcaggtgccttccgaatgggaaggtcggtgtgcggcaggtctgtcg
caacacccgctcgcaagatttgctgtgtaa

DBGET integrated database retrieval system