KEGG   Ralstonia pickettii 12D: Rpic12D_0529Help
Entry
Rpic12D_0529      CDS       T00925                                 

Definition
(GenBank) isocitrate lyase and phosphorylmutase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00630  Glyoxylate and dicarboxylate metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01200  Carbon metabolism
Module
rpf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic12D_0529
Enzymes [BR:rpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rpic12D_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACS61834
JGI: Rpic12D_0529
UniProt: C6BCX3
Position
1:559016..560602
Genome map
AA seq 528 aa AA seqDB search
MAQYQDDIKAVAGLKETYGSAWNAINPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPSKYTQSLGCWHGFIGQQKMISIKKHFKSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDPAAKAAIQEKIDNHVTHVVPIIA
DIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAI
RYAFLELGVDDGIIVARTDSLGAGLTKQIAVTNTPGDLGDQYNSFLDCEELSADQLGNGD
VVIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQNGADLLWIETEKPHIGQIGG
MVKEIRKVIPNAKLVYNNSPSFNWTLNFRQQVYDAMKEAGKDVSAYERGQLMSAEYDDSE
LAKLADEKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQ
RKEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQFH
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtatcaagacgacatcaaggcagttgccggtttgaaagagacctacggcagc
gcatggaacgcgatcaatcctgagtacgctgcccgcatgcgtgcccagaacaagttcaag
acgggtctggacatcgccaagtacaccgccaagatcatgcgcgcggacatggctgcctac
gacgccgatccgtccaagtacacgcagtcgctcggttgctggcacggcttcatcggccag
cagaagatgatttccatcaagaagcacttcaagagcaccgaacgccgctacctgtacctg
tctggctggatggtcgctgcgctgcgctcggagttcggcccgctgccggaccagtcgatg
cacgagaagacttcggtcagcgcgctgatccgcgagctgtacaccttcctgcgtcaagcg
gacgcccgcgagctgggtggcctgttccgcgaactggacgctgccaaggaccccgccgcc
aaggccgccatccaggaaaagatcgacaaccacgtcacccacgtcgtgcccatcattgcc
gacatcgacgccggtttcggcaatgcggaagcgacctacctgctggccaagcagttcatt
gaagcgggcgcctgctgcatccagatcgaaaaccaggtgtcggacgagaagcagtgcggc
caccaggacggcaaggtcaccgtgccgcacgaggacttcctggccaagatccgcgcgatc
cgttacgcgttcctggagctgggcgtggacgacggcatcatcgtcgcccgtaccgattcg
ctgggcgccggcctgaccaagcagatcgccgtgacgaacacgccgggcgacctgggcgac
caatacaactcgttcctcgattgcgaagaactgtcggctgaccaactgggcaacggtgac
gtcgtgatcaagcgtgacggcaagctgctgcgtccgaagcgcctgccgagcaacctgttc
cagttccgcgccggcacgggcgaagcgcgttgcgtgctcgactgcatcacctcgctgcaa
aacggcgcagacctgctgtggatcgaaaccgaaaaaccgcacatcggccagatcggcggc
atggtcaaggaaatccgcaaggtcatcccgaacgccaagctggtgtacaacaacagcccg
tcgttcaactggacgctgaacttccgtcagcaggtgtatgacgcgatgaaggaagccggc
aaggacgtgtcggcctacgagcgcggtcagctgatgagcgccgagtacgacgacagcgaa
ctcgcgaagctcgccgacgagaagatccgcaccttccaggccgatgcgtcgcgcgaagcc
ggcatcttccatcacctgatcacgctgccgacgtaccacaccgccgcgctgtcgaccgac
aacctggctaaggaatacttcggcgaccagggcatgctcggctacgtggctggcgtgcag
cgcaaggaaatccgtcagggcatcgcctgcgtcaagcaccagaacatgtcgggctcggac
atcggcgacgaccacaaggaatacttcagcggcgaagcggcgctgaaggctgcaggtaaa
gacaacaccatgaaccagttccactga

DBGET integrated database retrieval system