KEGG   Ralstonia pickettii 12D: Rpic12D_0570Help
Entry
Rpic12D_0570      CDS       T00925                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rpf00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rpf00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:604767..605738
Genome map
AA seq 323 aa AA seqDB search
MPKTFANPQLTKNGELKHLLSIEGLSRDILTHVLDTAQQFVSVSDSDREVKKVPLLRGKS
VFNLFFENSTRTRTTFEIAAKRLSADVINLNINASSTSKGESLLDTINNLSAMQADMFVV
RHASSGAPYLIAEHVAQHVHVINAGDGRHAHPTQGLLDMFTIRHYKKDFSNLTVAIVGDI
LHSRVARSDIHALTTLGCAEVRAIGPRTLLPGGLEHMGVRVFHNMEEGLKGVDVVIMLRL
QNERMSGALLPSAQEYFKAYGLTQDRLALAKPDAIVMHPGPMNRGVEIDSAVADGVQSVI
LNQVTFGIAVRMAVMGIVAGNND
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagacttttgccaacccgcagctcacgaaaaacggcgagctcaagcacttgctg
tcgatcgagggactgtcgcgcgacatccttacccacgtgctggacaccgctcagcagttc
gtttccgtgtcggattccgaccgcgaggtgaagaaggtgcccctgctgcgcggcaagagc
gtgttcaacctgttcttcgagaattccacgcgcacgcgcaccacgttcgagatcgcggcc
aagcggctgtcggcggacgtgatcaatctgaacatcaatgcgtcttccacgagcaagggc
gagtcgctgctcgacacgatcaacaatctgtcggcgatgcaggcggacatgtttgtcgtg
cggcatgccagttccggggcgccgtacctgatcgccgagcacgtggcgcagcatgtgcac
gtgatcaatgcgggcgatggccgtcatgcacaccccacgcaggggctgctcgacatgttc
accatccgtcactacaagaaggatttttccaacctgacggtggcgatcgtcggcgacatc
ctgcactcgcgcgtggcgcgttccgacatccacgcgctgacgacgctgggttgcgccgaa
gtgcgtgccatcggcccgcgcacgctgttgccgggcggactggagcacatgggcgtgcgg
gtcttccacaacatggaagagggcctgaagggcgtggatgtggtcatcatgctgcgcctg
cagaacgagcgcatgagcggtgcgctgttgccctccgcgcaggaatacttcaaggcctac
ggcctcacgcaggaccgcctggcgctggccaagccggacgccatcgtcatgcaccccggc
ccgatgaaccgcggcgtggagatcgactccgccgtggccgacggtgtgcaatcggtgatc
ctgaatcaggtgacgttcggcatcgcggtgcgcatggcggtcatgggcatcgtggctggc
aacaacgactaa

DBGET integrated database retrieval system