KEGG   Ralstonia pickettii 12D: Rpic12D_0600Help
Entry
Rpic12D_0600      CDS       T00925                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_0600
   00030 Pentose phosphate pathway
    Rpic12D_0600
   00051 Fructose and mannose metabolism
    Rpic12D_0600
   00052 Galactose metabolism
    Rpic12D_0600
   00500 Starch and sucrose metabolism
    Rpic12D_0600
   00520 Amino sugar and nucleotide sugar metabolism
    Rpic12D_0600
  Nucleotide metabolism
   00230 Purine metabolism
    Rpic12D_0600
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rpic12D_0600
Enzymes [BR:rpf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Rpic12D_0600
    5.4.2.8  phosphomannomutase
     Rpic12D_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:635444..636832
Genome map
AA seq 462 aa AA seqDB search
MRSINPTIFKAYDIRGIVGKTVDAETARLIGRAFGSAARAKGESAVVIGRDGRLSGPELL
AALADGLRASGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSHNPPDYNGFKMVL
AGQAIYGDQIQALRTRIEQSDFTEGSGDYVQVDIRQQYIDRIVSDVKLSRPMKIAVDCGN
GVAGAFAPELFRAMGCEVTELFCEVDGHFPNHHPDPAHVENLQDLVRTLQTTDCELGLAF
DGDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRNPGGEIIFDVKCTGKLAPFIREHGGKA
TMWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEIVSRLTDPSA
TLNALPNSHCTPELQLKCAEGESFQLLDKIKANATFAGAKEVNRIDGVRVEYEDGFGLAR
PSNTTPVVVMRFEADNDAAMARIQGEFRRVILAEKPDAQLPF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatcaaccccaccatcttcaaagcctacgacatccgcggcatcgtcggaaaa
accgtcgatgcggaaaccgcacgcctcatcggccgcgcttttggctccgcagcacgcgcc
aagggcgaatccgccgtcgtcatcggtcgcgatggccgcttgtctggcccggaactgctc
gcagcgctggcagacggcctgcgcgcgagcggcgtcgatgtgatcgatttgggtcttgtg
gccacgccgatggtctactttggcacaaacatcgagctggctggccgtcgcgccacgtcg
ggcgtgatggtcacgggcagccacaatccgcccgactacaacggcttcaagatggtgctg
gcgggccaggccatctatggcgatcaaatccaggcgctgcgcacgcgcatcgagcaaagc
gatttcactgagggctcaggcgattacgtccaggtggacatccgccaacagtacatcgac
cgaatcgtctcggacgtcaagctgagccgcccgatgaagattgccgtggactgcggcaac
ggtgtggcaggcgcctttgcgccggagctgttccgcgcgatgggctgcgaggtgacggag
ttgttctgcgaggtggatggccacttcccgaaccaccatccggacccggcccacgtcgag
aacctgcaggacctggtgcgcacgctgcagaccacggattgcgaactcggcctcgcgttc
gacggcgacggcgaccgcctgggcgtggtgaccaaggacggccaggtcatcttccccgac
cgccagttgatgctgttcgcgcaggaagttctgtcgcgcaacccgggcggcgaaatcatc
ttcgatgtgaagtgcacaggcaagttggccccgttcattcgtgagcacggcggcaaggcc
acgatgtggaagacgggccattcgctcgtcaaggccaagctgaaggaaacgggcgctccg
ctggccggcgagatgagcggccacattttcttcaaggatcgctggtacggtttcgatgac
ggtctttatacgggcgcccgcctgctggagatcgtctcgcgcctgacagatccgagcgcc
acgctgaatgcgctgccgaactcgcactgcacgcccgagctgcaactgaagtgtgcggag
ggcgaatcgttccaactgctcgacaagatcaaggccaatgccacgtttgccggcgcgaag
gaagtgaaccgcatcgacggcgtacgcgtggaatacgaagatggctttggcctggcgcgt
ccgtccaataccacgccggtggtcgtcatgcgcttcgaggctgacaacgatgccgcgatg
gcgcgcattcaaggcgaattccgccgcgtgatcctggccgagaagccggacgcgcaactg
ccgttctga

DBGET integrated database retrieval system