KEGG   Ralstonia pickettii 12D: Rpic12D_0600Help
Entry
Rpic12D_0600      CDS       T00925                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00010  Glycolysis / Gluconeogenesis
rpf00030  Pentose phosphate pathway
rpf00051  Fructose and mannose metabolism
rpf00052  Galactose metabolism
rpf00230  Purine metabolism
rpf00500  Starch and sucrose metabolism
rpf00520  Amino sugar and nucleotide sugar metabolism
rpf00521  Streptomycin biosynthesis
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_0600
   00030 Pentose phosphate pathway
    Rpic12D_0600
   00051 Fructose and mannose metabolism
    Rpic12D_0600
   00052 Galactose metabolism
    Rpic12D_0600
   00500 Starch and sucrose metabolism
    Rpic12D_0600
   00520 Amino sugar and nucleotide sugar metabolism
    Rpic12D_0600
  Nucleotide metabolism
   00230 Purine metabolism
    Rpic12D_0600
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rpic12D_0600
Enzymes [BR:rpf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Rpic12D_0600
    5.4.2.8  phosphomannomutase
     Rpic12D_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACS61905
JGI: Rpic12D_0600
UniProt: C6BDH0
Position
1:635444..636832
Genome map
AA seq 462 aa AA seqDB search
MRSINPTIFKAYDIRGIVGKTVDAETARLIGRAFGSAARAKGESAVVIGRDGRLSGPELL
AALADGLRASGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSHNPPDYNGFKMVL
AGQAIYGDQIQALRTRIEQSDFTEGSGDYVQVDIRQQYIDRIVSDVKLSRPMKIAVDCGN
GVAGAFAPELFRAMGCEVTELFCEVDGHFPNHHPDPAHVENLQDLVRTLQTTDCELGLAF
DGDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRNPGGEIIFDVKCTGKLAPFIREHGGKA
TMWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEIVSRLTDPSA
TLNALPNSHCTPELQLKCAEGESFQLLDKIKANATFAGAKEVNRIDGVRVEYEDGFGLAR
PSNTTPVVVMRFEADNDAAMARIQGEFRRVILAEKPDAQLPF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatcaaccccaccatcttcaaagcctacgacatccgcggcatcgtcggaaaa
accgtcgatgcggaaaccgcacgcctcatcggccgcgcttttggctccgcagcacgcgcc
aagggcgaatccgccgtcgtcatcggtcgcgatggccgcttgtctggcccggaactgctc
gcagcgctggcagacggcctgcgcgcgagcggcgtcgatgtgatcgatttgggtcttgtg
gccacgccgatggtctactttggcacaaacatcgagctggctggccgtcgcgccacgtcg
ggcgtgatggtcacgggcagccacaatccgcccgactacaacggcttcaagatggtgctg
gcgggccaggccatctatggcgatcaaatccaggcgctgcgcacgcgcatcgagcaaagc
gatttcactgagggctcaggcgattacgtccaggtggacatccgccaacagtacatcgac
cgaatcgtctcggacgtcaagctgagccgcccgatgaagattgccgtggactgcggcaac
ggtgtggcaggcgcctttgcgccggagctgttccgcgcgatgggctgcgaggtgacggag
ttgttctgcgaggtggatggccacttcccgaaccaccatccggacccggcccacgtcgag
aacctgcaggacctggtgcgcacgctgcagaccacggattgcgaactcggcctcgcgttc
gacggcgacggcgaccgcctgggcgtggtgaccaaggacggccaggtcatcttccccgac
cgccagttgatgctgttcgcgcaggaagttctgtcgcgcaacccgggcggcgaaatcatc
ttcgatgtgaagtgcacaggcaagttggccccgttcattcgtgagcacggcggcaaggcc
acgatgtggaagacgggccattcgctcgtcaaggccaagctgaaggaaacgggcgctccg
ctggccggcgagatgagcggccacattttcttcaaggatcgctggtacggtttcgatgac
ggtctttatacgggcgcccgcctgctggagatcgtctcgcgcctgacagatccgagcgcc
acgctgaatgcgctgccgaactcgcactgcacgcccgagctgcaactgaagtgtgcggag
ggcgaatcgttccaactgctcgacaagatcaaggccaatgccacgtttgccggcgcgaag
gaagtgaaccgcatcgacggcgtacgcgtggaatacgaagatggctttggcctggcgcgt
ccgtccaataccacgccggtggtcgtcatgcgcttcgaggctgacaacgatgccgcgatg
gcgcgcattcaaggcgaattccgccgcgtgatcctggccgagaagccggacgcgcaactg
ccgttctga

DBGET integrated database retrieval system