KEGG   Ralstonia pickettii 12D: Rpic12D_0869Help
Entry
Rpic12D_0869      CDS       T00925                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpf00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rpf00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpf02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:911015..912634
Genome map
AA seq 539 aa AA seqDB search
MSDQPIFKPTRRTLIKGLVSASGSALLGSRMGEVLAQGVAPAVVTSERLRPQVPGGVMSG
DITADSAIVWSRTDRPARMIVEYSTDAAFKNVARRVGPAALESNGLTARVDLTGLPAGAD
LFYRVRFQDLVHDKVFSEPVAGRFRTAPVQANRPICFVFSGDEAGQGWGINERFGGYRLY
EAMRRESPDFFIHSGDQIYADGPIQAEVQLPDGSLWTNFVTEAKSHVAQTLDDYRGAFAY
NQLDKNKRAFSAEVPFLVQWDDHEVRNNWYPGQQIGPEEKRYQERSASVLAARAKQAMFE
YNPFRFNPVDPEQIYRAFRYGPLLDVFMLDERSYRGRNSPNRQTTLDADSAFLGPAQTAW
LKQTLKQSKATWKVIASDMPISLVVPDLNPDVPKGTYEAWSNADDGAPSGRELELAEILR
FIKQENIQNVVWVTADVHYAQATYYHPSRAKFTEFKPFWEFVGGPINAGTFGPNEVDQTF
GPDLRYISIPKDNPQNQSPAALQQYYGRAKIDPATRTMLVSLHDLDGKSLWEVKLDPEA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccagccgatcttcaagccgacccgccgcacgctgatcaagggtcttgtttcc
gccagcggttccgcgctgctgggctcgcgtatgggcgaagtgttggcccagggcgttgca
ccggccgtggtgacgtccgagcgcctgcgtccgcaagtgcccggcggagtgatgagcggt
gatatcacggctgacagtgccatcgtctggagccgcaccgatcgtccggcacgcatgatc
gtcgaatactcgacggacgccgccttcaagaacgttgcgcgtcgcgttggcccagccgca
cttgaaagcaacggcctgacagcccgcgtcgatctgaccggtctgcctgccggcgcagac
ctgttctaccgcgtgcgcttccaggacctcgtgcacgataaggtcttcagcgagccggtt
gccggtcgcttccgcacggcgcccgtccaggccaatcgccccatctgcttcgttttctcc
ggcgacgaggccggccaggggtggggcatcaacgagcgtttcggcggctatcgtctgtac
gaagcgatgcgccgcgaatcgcccgacttcttcatccactccggcgatcagatctatgcc
gacggcccgatccaggccgaagtgcaactgcccgacggctcgctgtggaccaacttcgtt
accgaggcgaagtcgcacgttgcacagacgctcgacgactatcgcggcgcctttgcctac
aaccagctcgacaagaacaagcgcgcgttttccgccgaggtgccgttcctcgtgcagtgg
gacgaccacgaggtgcgcaacaactggtaccccggccagcagatcggcccggaagagaag
cgctatcaggagcgcagcgcatccgtgctggccgcccgcgcaaagcaggcgatgttcgag
tacaacccgttccgtttcaaccccgtcgaccccgagcagatctaccgcgcattccggtac
ggcccgctgctcgacgtgttcatgctggacgagcgcagttatcgcggtcgcaactcgccg
aaccggcagaccacgctggatgcggattccgctttcctcggcccggcgcagacggcgtgg
ctgaagcaaacgctcaagcagtcaaaggccacgtggaaggtgattgccagcgacatgccg
atctcgctggtggtgcctgatctgaacccggacgtgccaaagggtacctacgaagcctgg
tccaatgcggatgatggcgcgccgtcgggccgcgaattggaattggccgaaatcctgcgt
ttcatcaagcaggagaacatccagaacgtggtgtgggtgacggcagacgtgcactacgcg
caagcgacgtactaccacccgtcgcgcgccaaattcacggagttcaaaccgttctgggag
ttcgtcggcggcccgatcaacgcgggcacgttcgggcctaacgaagtggatcagaccttt
gggccggacctgcgctacatcagcattcccaaggacaatccgcagaaccagtcgccggca
gcgctgcagcagtattacggccgagccaagatcgacccggccacgcgcacgatgcttgta
tcgctgcacgatctcgacggcaaatcgctctgggaagtgaagctcgaccccgaggcgtag

DBGET integrated database retrieval system