KEGG   Ralstonia pickettii 12D: Rpic12D_0912Help
Entry
Rpic12D_0912      CDS       T00925                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rpf  Ralstonia pickettii 12D
Brite
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Rpic12D_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(961021..961845)
Genome map
AA seq 274 aa AA seqDB search
MTPSVPGSTAVLLIHGLGGTAYDVGVLQKALRNAGAVTHVPTLPGHGTRPEDLIHMPAEA
WLETLTQAYERLAAEHDTVHIAGMCMGALLALVLAHRVRHGIARPQNRLALLATPVHIDG
WSTPWYRDLRYAVYRIPGMAARMRVEEDEPFGIKNPLLRRIIKAKLARGDSFHYPWVPLA
CIRQVDRLRRWALAGAPDTQCQTLVIHSREDELTSLRSAQTLQATLPHARSVVLENSYHM
ICVDNDRDQVAAEVLGFFGFDPAAARRKGPAAAD
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccatcggtgcccggcagcacggccgtgctgctgatccatggtctgggcggcaca
gcctacgacgtgggcgtgctgcagaaagcgctgcgcaacgccggcgcggtcacgcacgtg
ccgaccttgcccggccacggcacgcgcccggaagacctgatccacatgcctgccgaggcg
tggcttgaaacgcttacgcaagcgtatgaacggcttgccgccgagcatgacaccgtgcat
atcgcggggatgtgcatgggcgcattgctggcactggtgctagcgcaccgggttcggcat
ggcattgcgcgcccgcagaacaggctggcgctgctcgccacgcccgtacatatcgatggc
tggtcgacgccgtggtatcgggatctgcgctacgcggtgtatcgcatcccgggcatggct
gcacgcatgcgcgtggaagaggacgagccgttcggcatcaagaacccgctgttgcggcgg
atcatcaaggcgaagctcgcgcgcggtgacagcttccactacccgtgggtgccgctggct
tgcattcggcaggtggaccgcctgcgacgctgggcactggccggggcgcccgatacgcag
tgccagacgctggtgatccattcgcgcgaagacgaactcaccagcctgcgttccgcccaa
acgctgcaggccaccctgccccatgcgcgcagcgtggtgctggaaaacagctaccacatg
atctgcgtggacaacgaccgcgatcaggtcgcagcagaggtccttggctttttcggcttc
gacccggcagcagccaggcgcaaaggcccagccgccgcagattga

  All links  
No link information was found.   
DBGET integrated database retrieval system