KEGG   Ralstonia pickettii 12D: Rpic12D_0943Help
Entry
Rpic12D_0943      CDS       T00925                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rpic12D_0943
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Rpic12D_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(993903..994868)
Genome map
AA seq 321 aa AA seqDB search
MVAKRPSASSAHPAADVLIVGSLNMDLVIRTPRLPRPGQTVAAPALETIPGGKGANQAVA
AARLGARVAMLGCVGDDAYGTALREGLRREGVDTSMVSVHAGAATGIACVTVANSGQNTI
VIVAGANEMLTPTMIEAQRAAFERARVIVCQLESPPDAVECALKLGQRLGKTVILNPAPA
IGPLPTPWLAACDYLIPNETEAALLTARPVDSPEAALDAAADLHAQGARHVIVTLGARGV
AYVDGDARQLMPAPVAQAIDTTAAGDTFVGALAAVLAEGAAPSAAIAFGQAAAAVSVTRL
GAQPSIPFRSELGAPAAPAPH
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaagcgcccttccgcctcttccgcgcaccccgctgccgacgtgctgatcgtc
ggcagcctgaacatggatctcgtgatccgcacgccccgcttgccgcgtcccgggcaaacg
gttgcagcccctgcgctggaaaccatccccggcggcaagggcgccaaccaggccgtggca
gccgcacgcctgggggcccgtgtcgccatgctcggctgcgtgggtgatgacgcgtacggc
accgcgttgcgcgagggcctgcgccgcgaaggcgtggacacatcgatggtgtcggtgcac
gccggagcggccaccggcattgcgtgcgtgaccgtggccaacagcggccagaacaccatc
gtcatcgtggccggcgccaacgaaatgctgacgccaacgatgatcgaagcgcagcgtgcc
gcgttcgagcgcgcacgcgtgatcgtctgtcagttggaatcaccaccggatgcggtggaa
tgcgcgctcaagctgggccagcggcttggcaagacggtcatcctgaatccggcacctgcg
atcggtccattgccgaccccgtggctcgccgcctgcgattacctgatcccgaatgaaacc
gaagccgcgttgctcacagcgcggccggtcgattcgccggaagcggctctggatgccgcc
gcggatctccacgcgcaaggtgcgcggcacgtgattgtcacgctgggcgcgcgaggcgtt
gcctatgtggatggcgacgcgcgccaactgatgcctgcccccgttgcccaagccatcgac
accaccgctgccggcgatacgtttgtgggcgcattggctgcggttctggcagagggcgca
gcgcccagtgccgccatcgcgtttgggcaagctgcggcggccgtgtcggtcacgcggctt
ggcgcgcagccgtccattccgttccgcagcgagttgggcgcaccggccgcgcccgcacct
cactag

DBGET integrated database retrieval system