KEGG   Ralstonia pickettii 12D: Rpic12D_0998Help
Entry
Rpic12D_0998      CDS       T00925                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rpf  Ralstonia pickettii 12D
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rpic12D_0998
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Rpic12D_0998
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rpic12D_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1047710..1048759
Genome map
AA seq 349 aa AA seqDB search
MTQTKKQKHPGPIVLDVAGLELGPDDVRRIAHPLTGGVILFARNFESRAQLTALTQAIRA
IRSDVLICIDHEGGRVQRAKTDGFTHLPAMGALGKLWDTDVLAATRAATACGYVLAAELR
ACDIDLSFTPVLDLDYGSSSVIGDRAFHRDPRVVTMLANHLTLGLRLAGMSNCGKHFPGH
GYVQADSHVAVPVDERPLEAILADDAQPYGWMGIGLQSVMPAHVIYSAVDPNPAGFSRFW
LQDMLRAHFNFDGVIFSDDLSMEGASVAGTVVDGARAALTAGCDMVLICNAPEKADQLLG
ELDVPMGKASQRRVRRLFGGRAVKDWAKLQQQSAYKQALRTLREAKLIK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaccaagaagcagaagcaccccggtccgatcgttctggatgttgccggcctg
gaactcggccccgacgacgtccgccgcattgcccacccgttgacgggcggcgtgatcctg
tttgcgcgtaactttgaatcgcgcgcgcagttgacggcgctcacgcaggccattcgcgcg
attcggagcgacgtgctgatttgcatcgaccacgaaggcggtcgcgtgcagcgcgccaag
accgacggtttcacgcatctgcccgccatgggcgcgctgggcaagctctgggacaccgat
gtgctagccgccacgcgcgctgccaccgcctgcggctacgtactggccgcagaactgcgc
gcgtgcgatatcgacctcagcttcacgcccgtgctcgatctcgactacggcagcagcagc
gtgatcggcgatcgcgcgtttcatcgcgacccgcgcgtggtcacgatgctagccaaccac
ttgacgctgggcctgcgcctggccggcatgtccaactgtggcaagcatttccccggtcac
ggctacgtccaagcggattcgcacgtcgccgtgccggtggacgagcgtccgctggaggcc
atcctcgctgacgacgcgcagccttacggctggatgggcatcggcctgcaatccgtgatg
ccggcgcacgtgatttattcagcggtcgatccgaacccggccggcttctctcgcttctgg
ctgcaggacatgctgcgcgcgcatttcaactttgacggcgtgatcttcagcgatgacttg
agcatggaaggcgcgagcgttgccggcacggtggtcgacggtgcgcgagcagcgctcacg
gcgggctgcgacatggtcttgatctgcaatgcgccggaaaaagccgaccaactgctcggc
gagcttgatgtgccgatgggcaaggcgtcgcagcggcgcgtgcgtcggctgtttggtggt
cgcgccgtaaaggactgggcaaaactgcagcaacaatcggcctacaagcaggcgctgcgc
acattgcgcgaggcgaagctcatcaagtaa

DBGET integrated database retrieval system