KEGG   Ralstonia pickettii 12D: Rpic12D_1130Help
Entry
Rpic12D_1130      CDS       T00925                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
rpf  Ralstonia pickettii 12D
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rpic12D_1130
DNA repair and recombination proteins [BR:rpf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Rpic12D_1130
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rpic12D_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:1195110..1195730
Genome map
AA seq 206 aa AA seqDB search
MRNAPGTPSALQMLVEALRVLPGVGPKSAQRMAYHLMQHDREGAAQLAQALSEATESIQH
CSRCNTFTEQDICETCLDTRRDASVLCVVETPADQMMIEQTLTYRGQYFVLMGRLSPLDN
IGPKEIHLERLLARATDPALGGPCTEVILATNFTSEGEATAHYIGEMLKARGIKATRLAR
GVPVGGELEYVDAGTIARAVLDRRQL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacgctccgggcacgccgtcggcgctgcagatgctggttgaggccttgcgcgtg
ctgccgggcgtcggccccaagtctgcccagcggatggcgtatcacctcatgcagcatgac
cgcgaaggcgccgcgcaactggcgcaggcgctgtcggaggcgacggaatcgatccagcac
tgcagccgctgcaatacctttacggagcaggatatttgcgagacctgccttgacacgcgc
cgtgacgcttcggtcctgtgcgtggtggaaacgccggctgatcagatgatgatcgagcag
acgctgacctatcgcggccaatacttcgtgctgatggggcggctctcgccgctggacaac
atcggcccgaaagagattcaccttgaacgcttgctggcccgtgcgaccgatcctgcgctg
ggcgggccgtgcaccgaggtcatcctcgccaccaacttcaccagcgaaggggaggcgaca
gcccattacattggcgagatgttgaaggcgcgcggcatcaaggcgacgcgtcttgcgcgt
ggcgtgccggtaggcggtgagctggaatacgtggacgcgggtaccatcgctcgcgccgtg
ctggaccggcgccaactctga

DBGET integrated database retrieval system