KEGG   Ralstonia pickettii 12D: Rpic12D_1141Help
Entry
Rpic12D_1141      CDS       T00925                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpf  Ralstonia pickettii 12D
Brite
Enzymes [BR:rpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rpic12D_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 RrnaAD Methyltransf_23 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: ACS62433
JGI: Rpic12D_1141
UniProt: C6BGD4
Position
1:1206239..1207183
Genome map
AA seq 314 aa AA seqDB search
MSERPRDRRFPLTLDAVVERKPAEPQRKTRISSGVSAVSRPTPVRAASVERASPAAAPAP
APQRVAGVDAAVGAVAASAVQARTAAAHAAAGGMASDRARQTLVGRVQGGGVSDKRVLAA
IGTVPRHLFVDAGLASQAYEDSALPIGHQQTISKPSVVGRMIELLLNGRSRRTGMPLARV
LEIGTGCGYQAAVLAQLADEVYSIERVRPLHEKAKANLRPLRVPNIRLHYGDGMLGLPKA
APFDAIILAAAGLEVPQALLDQLTVGGRLIAPVATDRNSGPAQQLVLIERRSRFEFHSTA
LEGVFFVPLKSGTV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgcccgcgcgaccggcgcttcccgttgacgctcgatgcagtggtcgagcgt
aagccggcggagccccagcgtaaaacgcgaatctcgtccggggtaagcgcagtctcacgc
cccacgccggtgcgtgcggcatccgtggagcgcgcgtcgcccgctgccgcccccgcacct
gcgccgcaacgcgtggcgggggtcgacgctgcggtcggcgccgtcgctgcgagcgccgtg
caggcacgcacggcggcagcgcatgcggcggcgggcggcatggcgtcggaccgcgcgcgt
cagacattggttggccgtgtgcaaggagggggcgtgagtgacaagcgcgtgctcgctgca
atcggcaccgtgccacgccatctgtttgtcgatgccggcctggcgtcgcaggcgtatgaa
gactccgcattgccgattggtcatcagcaaacgatctcgaagccgtcagtggtcgggcgg
atgatcgagttgttgttgaatggacggtcgcgccgcaccggcatgccgctggcacgtgtg
ctggaaatcggcactggctgcggctaccaggcagccgttctcgcgcaactcgccgacgag
gtgtactccatcgagcgcgttcgtccgctgcatgaaaaagccaaagcgaacttgcggcca
ctccgcgtgccaaacatccgcctgcactatggcgacggcatgctcgggctgccgaaggcc
gcgccgttcgacgccatcatcctggcggcagcggggctggaggtgccgcaggcgctgctc
gaccagctgaccgttggcggccggctgatcgcccccgttgccaccgaccgcaacagcggt
ccggcgcagcagctcgttctcattgagcgccgcagccgcttcgagtttcacagtaccgcg
cttgaaggcgttttctttgtcccgttaaaatcaggaactgtttag

DBGET integrated database retrieval system