KEGG   Ralstonia pickettii 12D: Rpic12D_1191Help
Entry
Rpic12D_1191      CDS       T00925                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic12D_1191
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpic12D_1191
  Amino acid metabolism
   00310 Lysine degradation
    Rpic12D_1191
Enzymes [BR:rpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rpic12D_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1263321..1264574
Genome map
AA seq 417 aa AA seqDB search
MAIVEVKVPQFSESVEEGTLISWKKKPGEAVAQDEILIEVETDKVVLEVPAPSAGVLAEV
LVADGATVTSEQLLAKIDTEGKAGAAAPAAAAPAPVAAAPAPAAAAPAAAAAGGVAMPSA
AKLMAENNLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAAAAAPQAARPALQQVAAPVDF
AALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKDQFEKTH
GVKLGFMSFFVKAAVHALKKYPIINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRNAD
QMSLADIEKKIAEFGQKAKDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINPPQSAILGV
HATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLLDL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgaagtcaaggtcccgcagttttccgagtccgttgaagagggcacgctg
atctcctggaagaagaagccgggcgaagccgtggcccaggacgaaatcctcattgaagtc
gagaccgacaaggttgtactggaagtgccggccccgtcggctggcgtgctggctgaagtg
ctggtggcagacggcgcaaccgtgacgtcggaacagctgctggccaagatcgacaccgaa
gggaaggcaggcgccgcggctccggcagctgctgcaccggcccccgtggctgctgcaccg
gcaccggctgctgccgctccggccgccgctgcagcgggtggcgtggcgatgccgtcggct
gccaagctgatggccgagaacaacctgtcggctggccaagtggccggcacgggccgcgat
ggccgcatcaccaaaggcgacgtgctgggtgccgtggccggtggcgccaagccggctgct
gctgccgctccgcaagccgcacgtccggcgctgcagcaagtggctgctccggtggacttc
gccgccctgggcgaccgtccggaagagcgcgtgccgatgagccgcctgcgtgcccgtatc
gccgagcgtctggtgcagtcgcaatcgaccaacgccatcctcaccaccttcaacgaagtc
aacatgaagccggtgatggacttgcgcgccaagttcaaggaccagttcgagaagactcac
ggcgtgaagctgggcttcatgtcgttcttcgtgaaggccgctgtccacgcgctgaagaag
tacccgatcatcaacgcatcggttgacggcaacgacatcgtctaccacggctacttcgac
atcggtatcgctgtcggctcgccgcgcggcctggtggtgcccatcctgcgcaatgccgac
cagatgagcctggccgatatcgagaagaagattgctgaattcggccagaaggccaaggac
ggcaagctgacgctggacgacctgaccggcggtacgttctcgatctcgaacggcggcacg
ttcggctcgatgctgtccaccccgatcatcaacccgccgcaatcggccatcctgggcgtg
cacgccaccaaggatcgcgccgtagtggagaacggccaggtcgtggttcgcccgatgaac
tacctggccatgtcctacgaccaccgcatcatcgacggccgcgaagccgttctgggcctg
gtggcgatgaaggaagcgctggaagacccggcccgcctgctgctggatctctaa

DBGET integrated database retrieval system