KEGG   Ralstonia pickettii 12D: Rpic12D_1264Help
Entry
Rpic12D_1264      CDS       T00925                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rpic12D_1264
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic12D_1264
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rpic12D_1264
Enzymes [BR:rpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rpic12D_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1336443..1337888
Genome map
AA seq 481 aa AA seqDB search
MQYRSTRGHAEPQSFSRILLGGLAPDGGLYLPEQYPQVSVDELTRWRDLPYADLAFEILR
KFATDIPEDDLRALTRRTYTPDVYCNARAGDNTADITPLHKLGEEGGTSLSLLCLSNGPT
LAFKDMAMQLLGNLFEYALDREHAELNILGATSGDTGSAAEYAMRGKRGVRVFMLSPHRK
MSAFQTAQMFSLQDKNIFNIAIEGVFDDAQDIVKAVSNDLDYKARQKIGTVNSINWARVV
AQVVYYFKGYLLAAPKIGDKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGTYRVRSAAQTYHTSSPSMDISKASNFERFVFDLLDRDPARLAQLFRDVDEKGGF
SMTGKPEFDRIAEFGFVSGRSSHDDRVDTIRDVFATYGTMIDTHTADGVKVARENLTPGV
PMVVLETALPAKFGDTIREALDREPERPAGYADIESLPQRFEVMPADVDRIKGYIAQHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccgatcgacccgcggccacgcagagccgcaaagtttttcccgcatcttgttg
ggcggcctggcgccggacggcggcctgtacctgccggagcaatacccgcaggtcagcgtt
gacgaactgacccgctggcgcgacctgccgtacgctgacctcgcgttcgaaatcctgcgc
aagttcgccaccgacattcccgaggacgacctgcgtgcgctgacccgccgcacctataca
cccgacgtctactgcaacgcgcgcgctggcgacaataccgccgacatcacgccgctccac
aagctgggcgaagagggcggcacgtcgctctcgctgctgtgtctttcgaatggcccgacg
ctggccttcaaggacatggcgatgcagctgctgggcaacctgttcgaatacgcgctcgac
cgtgaacacgctgaactgaacatcctgggtgcgacttccggcgacacgggcagcgcagcc
gaatacgcgatgcgcggcaagcgcggcgtgcgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagactgcgcagatgttcagcctgcaagacaagaacatcttcaacatc
gccatcgaaggcgtgttcgacgacgcgcaggacatcgtcaaggcggtgtcgaacgatctc
gactacaaggcgcgccagaagatcggcacggtcaattcaatcaactgggcgcgcgttgtt
gcccaggtcgtctactacttcaagggctacctgctggcggccccgaagatcggcgacaag
gtgtcattctgcgtgccgtcgggcaacttcggcaatgtctgcgccggccacatcgcgcgc
atgatgggtttgccaatcgacaagctggtcgttgccacgaacgagaacgacgtgctcgac
gagttcttccgtaccggcacgtaccgcgtgcgttcggccgcccagacgtatcacacgtcc
agccccagcatggacatcagcaaggcgtcgaacttcgagcgcttcgtgttcgacctgctg
gatcgtgatccggcgcgcctcgcccagctcttccgcgacgtggacgaaaagggcggcttc
tcgatgactggcaagccggagttcgaccgcatcgccgagttcggctttgtctcgggccgc
agctcgcacgacgaccgcgtcgatacgatccgcgatgtgtttgccacctacggcacgatg
atcgacacccacaccgccgatggcgtgaaggtggcgcgcgagaacctgacgccgggcgtg
ccgatggtggtgctggaaacggcgttgccggccaagttcggcgacaccattcgcgaagcg
ctggatcgggagccggagcgcccggctggttacgccgatatcgagtcgctgccgcagcgc
tttgaagtcatgccggccgacgttgaccgcatcaagggctacatcgcccagcacaccggt
ctctga

DBGET integrated database retrieval system