KEGG   Ralstonia pickettii 12D: Rpic12D_1264Help
Entry
Rpic12D_1264      CDS       T00925                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rpic12D_1264
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic12D_1264
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rpic12D_1264
Enzymes [BR:rpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rpic12D_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1336443..1337888
Genome map
AA seq 481 aa AA seqDB search
MQYRSTRGHAEPQSFSRILLGGLAPDGGLYLPEQYPQVSVDELTRWRDLPYADLAFEILR
KFATDIPEDDLRALTRRTYTPDVYCNARAGDNTADITPLHKLGEEGGTSLSLLCLSNGPT
LAFKDMAMQLLGNLFEYALDREHAELNILGATSGDTGSAAEYAMRGKRGVRVFMLSPHRK
MSAFQTAQMFSLQDKNIFNIAIEGVFDDAQDIVKAVSNDLDYKARQKIGTVNSINWARVV
AQVVYYFKGYLLAAPKIGDKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGTYRVRSAAQTYHTSSPSMDISKASNFERFVFDLLDRDPARLAQLFRDVDEKGGF
SMTGKPEFDRIAEFGFVSGRSSHDDRVDTIRDVFATYGTMIDTHTADGVKVARENLTPGV
PMVVLETALPAKFGDTIREALDREPERPAGYADIESLPQRFEVMPADVDRIKGYIAQHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccgatcgacccgcggccacgcagagccgcaaagtttttcccgcatcttgttg
ggcggcctggcgccggacggcggcctgtacctgccggagcaatacccgcaggtcagcgtt
gacgaactgacccgctggcgcgacctgccgtacgctgacctcgcgttcgaaatcctgcgc
aagttcgccaccgacattcccgaggacgacctgcgtgcgctgacccgccgcacctataca
cccgacgtctactgcaacgcgcgcgctggcgacaataccgccgacatcacgccgctccac
aagctgggcgaagagggcggcacgtcgctctcgctgctgtgtctttcgaatggcccgacg
ctggccttcaaggacatggcgatgcagctgctgggcaacctgttcgaatacgcgctcgac
cgtgaacacgctgaactgaacatcctgggtgcgacttccggcgacacgggcagcgcagcc
gaatacgcgatgcgcggcaagcgcggcgtgcgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagactgcgcagatgttcagcctgcaagacaagaacatcttcaacatc
gccatcgaaggcgtgttcgacgacgcgcaggacatcgtcaaggcggtgtcgaacgatctc
gactacaaggcgcgccagaagatcggcacggtcaattcaatcaactgggcgcgcgttgtt
gcccaggtcgtctactacttcaagggctacctgctggcggccccgaagatcggcgacaag
gtgtcattctgcgtgccgtcgggcaacttcggcaatgtctgcgccggccacatcgcgcgc
atgatgggtttgccaatcgacaagctggtcgttgccacgaacgagaacgacgtgctcgac
gagttcttccgtaccggcacgtaccgcgtgcgttcggccgcccagacgtatcacacgtcc
agccccagcatggacatcagcaaggcgtcgaacttcgagcgcttcgtgttcgacctgctg
gatcgtgatccggcgcgcctcgcccagctcttccgcgacgtggacgaaaagggcggcttc
tcgatgactggcaagccggagttcgaccgcatcgccgagttcggctttgtctcgggccgc
agctcgcacgacgaccgcgtcgatacgatccgcgatgtgtttgccacctacggcacgatg
atcgacacccacaccgccgatggcgtgaaggtggcgcgcgagaacctgacgccgggcgtg
ccgatggtggtgctggaaacggcgttgccggccaagttcggcgacaccattcgcgaagcg
ctggatcgggagccggagcgcccggctggttacgccgatatcgagtcgctgccgcagcgc
tttgaagtcatgccggccgacgttgaccgcatcaagggctacatcgcccagcacaccggt
ctctga

DBGET integrated database retrieval system