KEGG   Ralstonia pickettii 12D: Rpic12D_1302Help
Entry
Rpic12D_1302      CDS       T00925                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic12D_1302
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic12D_1302
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic12D_1302
Enzymes [BR:rpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rpic12D_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1374835..1376415
Genome map
AA seq 526 aa AA seqDB search
MALTLPQGMEIKAEILPAYEDILTPEALALVAKLHRAFQPRRKELLAARVERAKRLDAGE
RPDFLPETKAVREGDWKVAPIPPALHCRRVEITGPVDAKMVINAFNSGADSYMTDFEDSN
SPSWHNQIQGQVNLKAAIRRTLTLEQNGKTYKLNDKIATLQVRPRGWHLDEKHVLIDGER
VSGGIFDFALFFFHNAKEQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMEEILYELREHSAGLNAGRWDYIFSCIKKFKVDKNFCLADRAKVTM
TSPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNAIAMAGIINDKKRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGEKPNQFEKQRPDVEVKAADLLDFQPETPITEGGLRMNI
NVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGTKVTAELVRK
LIPEELAKVKETGAVGHFDRAAEIFEQMSTSEDFAEFLTLPLYEEI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcacgctgccccaaggcatggagatcaaggctgagattctgccggcctacgaa
gacattctgacccccgaagcactggcgctggtcgccaagctgcaccgtgccttccagccg
cgtcgtaaagagctgctggctgcccgtgtcgagcgcgccaagcgcctggacgccggcgag
cgcccggatttcctgccggaaacgaaggccgtgcgtgaaggcgactggaaggttgcaccg
atcccgccggcactgcattgccgccgcgtggaaatcaccggtccggtcgatgccaagatg
gtcatcaacgcgttcaactcgggcgcggacagctacatgaccgacttcgaagattcgaat
tcgccgagctggcacaaccagatccagggccaggtcaacctgaaggccgccatccgccgc
acgctcacgctggagcagaacggcaagacctacaagctcaacgacaagatcgccacgctg
caggtgcgtccgcgcggctggcatctggacgagaagcatgtgctgatcgacggcgagcgc
gtgtccggcggcatcttcgactttgcgctgttcttcttccacaacgcaaaggagcagatt
gctcgcggcgccggcccgttcttctatctgccgaagatggaaagccatctggaagcgcgt
ctgtggaacgacatcttcgtgatggcgcagaacgagatcggccttccgcagggcacgatc
aaggccaccgtgctgatcgaaaccatcctcgccgcgttcgagatggaagaaatcctgtac
gaactgcgcgagcacagcgcaggcctgaacgccggccgttgggactacatcttctcgtgc
atcaagaagttcaaggtcgacaagaacttctgcctggccgaccgcgccaaggtgacgatg
acctcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccacaagcgcggt
gcgcccgcaatcggcggcatgagcgcgctgatcccgatcaagaacgatccggagaagaac
gccatcgccatggccggcatcatcaacgacaagaagcgcgacgcgaccgacggctacgac
ggcggctgggtggcgcacccgggcctggtcgagccggccatgaaggaattcgtggcagtg
ctgggcgagaagccgaaccagttcgagaagcaacgcccggacgtggaagtgaaggctgcg
gacctgctggacttccagccggaaacgccgatcaccgaaggtggcctgcgcatgaacatc
aacgtcggcatccactacctaggtgcctggctggccggcaacggttgcgtgcctatccac
aacctgatggaagatgccgccacggcggaaatctcccgctcccaggtgtggcagtggatc
cgctcgccgaagggcaagctggaagacggcaccaaggtcacggctgaactggtgcgcaag
ctgatcccggaagaattggccaaggtgaaggagacgggcgcggtgggccactttgaccgc
gctgcagaaatcttcgaacagatgtcgacgtcggaagactttgccgaattcctgacactg
ccgctgtacgaagaaatctaa

DBGET integrated database retrieval system