KEGG   Ralstonia pickettii 12D: Rpic12D_1302Help
Entry
Rpic12D_1302      CDS       T00925                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic12D_1302
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic12D_1302
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic12D_1302
Enzymes [BR:rpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rpic12D_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1374835..1376415
Genome map
AA seq 526 aa AA seqDB search
MALTLPQGMEIKAEILPAYEDILTPEALALVAKLHRAFQPRRKELLAARVERAKRLDAGE
RPDFLPETKAVREGDWKVAPIPPALHCRRVEITGPVDAKMVINAFNSGADSYMTDFEDSN
SPSWHNQIQGQVNLKAAIRRTLTLEQNGKTYKLNDKIATLQVRPRGWHLDEKHVLIDGER
VSGGIFDFALFFFHNAKEQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMEEILYELREHSAGLNAGRWDYIFSCIKKFKVDKNFCLADRAKVTM
TSPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNAIAMAGIINDKKRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGEKPNQFEKQRPDVEVKAADLLDFQPETPITEGGLRMNI
NVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGTKVTAELVRK
LIPEELAKVKETGAVGHFDRAAEIFEQMSTSEDFAEFLTLPLYEEI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcacgctgccccaaggcatggagatcaaggctgagattctgccggcctacgaa
gacattctgacccccgaagcactggcgctggtcgccaagctgcaccgtgccttccagccg
cgtcgtaaagagctgctggctgcccgtgtcgagcgcgccaagcgcctggacgccggcgag
cgcccggatttcctgccggaaacgaaggccgtgcgtgaaggcgactggaaggttgcaccg
atcccgccggcactgcattgccgccgcgtggaaatcaccggtccggtcgatgccaagatg
gtcatcaacgcgttcaactcgggcgcggacagctacatgaccgacttcgaagattcgaat
tcgccgagctggcacaaccagatccagggccaggtcaacctgaaggccgccatccgccgc
acgctcacgctggagcagaacggcaagacctacaagctcaacgacaagatcgccacgctg
caggtgcgtccgcgcggctggcatctggacgagaagcatgtgctgatcgacggcgagcgc
gtgtccggcggcatcttcgactttgcgctgttcttcttccacaacgcaaaggagcagatt
gctcgcggcgccggcccgttcttctatctgccgaagatggaaagccatctggaagcgcgt
ctgtggaacgacatcttcgtgatggcgcagaacgagatcggccttccgcagggcacgatc
aaggccaccgtgctgatcgaaaccatcctcgccgcgttcgagatggaagaaatcctgtac
gaactgcgcgagcacagcgcaggcctgaacgccggccgttgggactacatcttctcgtgc
atcaagaagttcaaggtcgacaagaacttctgcctggccgaccgcgccaaggtgacgatg
acctcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccacaagcgcggt
gcgcccgcaatcggcggcatgagcgcgctgatcccgatcaagaacgatccggagaagaac
gccatcgccatggccggcatcatcaacgacaagaagcgcgacgcgaccgacggctacgac
ggcggctgggtggcgcacccgggcctggtcgagccggccatgaaggaattcgtggcagtg
ctgggcgagaagccgaaccagttcgagaagcaacgcccggacgtggaagtgaaggctgcg
gacctgctggacttccagccggaaacgccgatcaccgaaggtggcctgcgcatgaacatc
aacgtcggcatccactacctaggtgcctggctggccggcaacggttgcgtgcctatccac
aacctgatggaagatgccgccacggcggaaatctcccgctcccaggtgtggcagtggatc
cgctcgccgaagggcaagctggaagacggcaccaaggtcacggctgaactggtgcgcaag
ctgatcccggaagaattggccaaggtgaaggagacgggcgcggtgggccactttgaccgc
gctgcagaaatcttcgaacagatgtcgacgtcggaagactttgccgaattcctgacactg
ccgctgtacgaagaaatctaa

DBGET integrated database retrieval system