KEGG   Ralstonia pickettii 12D: Rpic12D_1327Help
Entry
Rpic12D_1327      CDS       T00925                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00300  Lysine biosynthesis
rpf01100  Metabolic pathways
rpf01120  Microbial metabolism in diverse environments
rpf01230  Biosynthesis of amino acids
Module
rpf_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rpic12D_1327
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rpic12D_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ACS62616
JGI: Rpic12D_1327
UniProt: C6BHK9
Position
1:complement(1401929..1403080)
Genome map
AA seq 383 aa AA seqDB search
MQPTLALTEDLIRRRSVTPEDKGCQDVLIERLTAAGFECETVVSGPDHFRVTNLWAVKRG
TAGTAGKLLVFAGHTDVVPTGPVEQWHSDPFEPTHRDGKLYARGAADMKTSIAGFVVASE
EFVAKHPDHAGSIGFLITSDEEGPAHDGTVKVCDLLRARGERLDYCVVGEPTSVSTLGDM
VKNGRRGSLSGKLTVNGVQGHIAYPHLAKNPIHLAAPALAELAATKWDDGNAYFPPTTWQ
MSNIHGGTGATNIIPGHVTIDFNFRFSTASTPDGLKARVHGILDAHGLDYTLDWTLGGEP
FLTERGELSDALASAIQAECGVTTELSTTGGTSDGRFIAKICPQVIEFGPPNASIHKIDE
HVEVAFIEPLKNVYRRVLETLIA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccacgcttgccctcactgaagacctgatccgccgccgctccgtcacgcccgaa
gacaagggctgccaggacgtgctgatcgaacgcctgaccgccgccggcttcgaatgcgaa
accgtggtcagcggcccggaccactttcgcgtgaccaacctgtgggccgtcaagcgcggc
acggccggcaccgcaggcaagctgctcgtcttcgcgggccacaccgatgtggtgcccacc
ggccccgtcgagcaatggcactccgacccgttcgagcccacacaccgtgacggcaagctc
tacgcgcgcggcgcggcagacatgaagacgtcgattgccggcttcgtggtggcctcggaa
gaatttgttgccaagcacccggaccacgccggctcgatcggctttctgatcaccagcgac
gaagaaggccccgcgcacgacggcaccgtcaaggtatgcgacctgctccgcgcacgcggc
gagcgcctcgattactgcgtggtcggtgagccgacttcggtgtcgaccctcggcgacatg
gtcaagaacgggcggcgcggttcgttgtcgggcaagctcacggtgaatggtgtgcaggga
cacatcgcgtatccgcatctggccaagaacccgatccacctggccgcgccggcgctggct
gagctggccgccacgaagtgggacgacggcaatgcatacttcccgccgaccacgtggcag
atgtcgaatattcacggcggcacgggcgcgacgaacatcattcctggccacgtcacgatc
gacttcaacttccgcttctcgaccgccagcacgccggacggcctgaaggcgcgcgtgcac
ggcattctcgatgcgcacggcctcgactacacgctcgactggacgctgggcggcgagccc
tttctgaccgagcgcggcgagctgtccgatgccctcgcctccgccatccaggccgaatgc
ggcgtgacgacggagctatcgaccacgggtggcacgtcggacggccgcttcatcgccaag
atctgcccgcaggtcattgagttcggcccgccgaacgcgagcatccacaagatcgacgaa
cacgtcgaagtggcattcatcgagccgctgaaaaacgtgtatcgccgcgtcttggaaacg
ttgatcgcctga

DBGET integrated database retrieval system