KEGG   Ralstonia pickettii 12D: Rpic12D_1530Help
Entry
Rpic12D_1530      CDS       T00925                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rpf01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1620757..1621365
Genome map
AA seq 202 aa AA seqDB search
MLPLAQTAAAQGAPASHRVVVLGDSLSAGYGLAQGTGWVALLDRRLKERQPDYSVANASI
SGDTTAGGRSRLPAVLAREKPSIVILELGGNDALRGLSLASSEANMKAMIEASQAAGARV
LLVGMRIPPNYGPDYSERFFAMFGKLAQQYKLPLVPFLLEGVAQRPDWFQEDRIHPIAAA
QPTMLDNVWPKLEPLLKARVGR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgctgccactcgcacagacggctgcagcacaaggcgcgcctgcatcgcatcgcgtggtg
gtgctcggtgacagcctgtcggcgggatacggcctggcacaaggcacaggatgggtggcg
ctgctcgacaggcgcctcaaagaacggcagcccgattatagcgtcgccaatgcaagcatc
agcggcgacaccacggccggcggccgctcgcgcctgcccgccgtgctggcccgcgaaaag
ccctccatcgtgattctcgaactgggcggcaacgatgccctacggggcctctcgctcgcc
tccagcgaggccaacatgaaagcaatgatcgaagcgtcgcaagcagccggcgcgagggtg
ctgctggttggcatgcgcatcccgcccaactacggtccggattacagcgagcgtttcttc
gccatgttcggcaagctggcgcagcagtacaagctgccactggtgccattcctgctcgaa
ggggttgcgcagcggcccgactggttccaggaagatcgcatccaccccattgccgcagcg
cagccgacgatgctcgataacgtgtggcccaaactggaacctctccttaaagcccgggtc
ggaagataa

DBGET integrated database retrieval system