KEGG   Ralstonia pickettii 12D: Rpic12D_1618Help
Entry
Rpic12D_1618      CDS       T00925                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00010  Glycolysis / Gluconeogenesis
rpf00020  Citrate cycle (TCA cycle)
rpf00620  Pyruvate metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
rpf01200  Carbon metabolism
Module
rpf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_1618
   00020 Citrate cycle (TCA cycle)
    Rpic12D_1618
   00620 Pyruvate metabolism
    Rpic12D_1618
Enzymes [BR:rpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rpic12D_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA DEC-1_N HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACS62902
JGI: Rpic12D_1618
UniProt: C6BIX9
Position
1:complement(1717189..1718874)
Genome map
AA seq 561 aa AA seqDB search
MSQVVEIKVPDIGDYKDVPVIEVLVKAGDTVNAEDSLVTLESDKATMDVPSPKSGVVKEV
KIKVGDTVSEGSLVLLLEEQGAAAAPAPAPQAAPAPAPTAAAPAPAPVAQAPAAAPAAAG
GGTIEVKVPDIGDYTDVPVIEISVKVGDKVEAEQSLITLESDKATMDVPSPAAGTVKDIR
VKVGDAVSQGTLIVVLEGAGGAAAAPAPAQAPVPAPTAAPAAAAPSPAPAAAPAAAPAAA
PATYTADTVGTVGKAAHASPSVRKYARELGVNVNLVGGTGPKNRITQEDVQRYVKSVMSG
QAAAPGKAAATAPAGGGELNLLPWPKVDFTKFGPVDPKPLSRIKKISGANLHRNWVMIPH
VTNNDEADITELEAFRVQMNKDHEKAGVKFTMLAFVIKAVVGALKKFPTFNASLDGDNLV
FKQYFHIGFAADTPNGLVVPVIRDADKKGLIDIAKEMADLSKAAREGKLKPDQMQGGCFS
ISSLGGIGGTHFTPIINAPEVAILGLSRGYQKPVWDGKQFVPRLTLPLSLSYDHRVIDGA
EAARFNAYLASVLADFRRVSL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtcgtagaaatcaaggtgccggacatcggcgactacaaagacgtcccggtg
atcgaagtgctggtcaaggcgggcgataccgtcaacgccgaggattcgctggtcacgctg
gaatcggacaaggcgaccatggacgtgccctcgcccaagagcggcgtcgtcaaggaagtg
aagatcaaagtgggtgacaccgtgtcggaaggctcgctggtgctgctgctcgaagagcag
ggcgctgctgccgcaccggccccggcacctcaagctgcgcccgcaccggctccgaccgct
gctgcaccggcacccgcaccggtcgcgcaagctccggccgctgcgccggctgccgctggc
ggcggcacgatcgaagtgaaagtgccggacatcggcgactacaccgacgtgccggtcatc
gagatcagcgtgaaggtgggcgacaaggtggaagccgagcagtccctgatcacgctggag
tcggacaaggccacgatggatgtgccgtcgccggccgccggtaccgtcaaggacatccgc
gtgaaggtgggcgatgccgtgtcgcaaggcacgctgatcgtcgtgctggagggtgctggc
ggtgctgccgctgcgccggcacctgcgcaagccccggtaccggcacccacagccgcaccg
gcggccgctgcaccgagcccggcccctgcggctgcgcccgcagctgctccggccgcagcg
cccgctacatacaccgccgacaccgtcggtacagtgggcaaggcggcccacgccagcccc
tcggtgcgcaagtacgcgcgtgaactgggcgtgaacgtcaacctggttggcggcaccggt
ccgaagaaccgtatcacgcaggaagacgtgcagcgctacgtcaagagcgtgatgagcggc
caggccgctgcgccgggcaaggctgccgcaactgcgccggccggcggtggcgagctgaac
ctgctgccgtggccgaaggtggacttcaccaagttcggcccggtcgatccgaagccgctg
tcgcgcatcaagaagatttcgggtgcgaacctgcaccgcaattgggtcatgatcccgcac
gtcacgaacaatgacgaagcggacatcaccgagctggaagccttccgcgtgcagatgaac
aaggaccacgaaaaggccggcgtgaaattcacgatgctggcgttcgtgatcaaggcagtc
gtgggtgcgctgaagaagttcccgaccttcaacgcgagcctggacggcgacaacctggtc
ttcaagcagtatttccacatcggctttgcggctgatacgcccaacgggctggtggtgccg
gtgatccgcgatgcggacaagaaggggctgatcgacatcgccaaggaaatggcggacctc
tcgaaggctgcgcgcgaagggaaactcaagccggaccagatgcagggcggctgcttctcg
atctcgtcgctgggcggtattggcggcacgcatttcacgccgatcatcaacgcaccggaa
gtggccatcctcggcctgtcgcgcggttatcagaagccggtgtgggacggcaagcagttc
gtgccgcgcctgacgctgccgctgtcgctgtcgtacgatcaccgcgtgatcgacggcgcc
gaggctgcgcgcttcaacgcgtatctggccagcgtgctggcggacttccgccgcgtcagc
ctgtaa

DBGET integrated database retrieval system