KEGG   Ralstonia pickettii 12D: Rpic12D_1618Help
Entry
Rpic12D_1618      CDS       T00925                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic12D_1618
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_1618
   00020 Citrate cycle (TCA cycle)
    Rpic12D_1618
   00620 Pyruvate metabolism
    Rpic12D_1618
Enzymes [BR:rpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rpic12D_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1717189..1718874)
Genome map
AA seq 561 aa AA seqDB search
MSQVVEIKVPDIGDYKDVPVIEVLVKAGDTVNAEDSLVTLESDKATMDVPSPKSGVVKEV
KIKVGDTVSEGSLVLLLEEQGAAAAPAPAPQAAPAPAPTAAAPAPAPVAQAPAAAPAAAG
GGTIEVKVPDIGDYTDVPVIEISVKVGDKVEAEQSLITLESDKATMDVPSPAAGTVKDIR
VKVGDAVSQGTLIVVLEGAGGAAAAPAPAQAPVPAPTAAPAAAAPSPAPAAAPAAAPAAA
PATYTADTVGTVGKAAHASPSVRKYARELGVNVNLVGGTGPKNRITQEDVQRYVKSVMSG
QAAAPGKAAATAPAGGGELNLLPWPKVDFTKFGPVDPKPLSRIKKISGANLHRNWVMIPH
VTNNDEADITELEAFRVQMNKDHEKAGVKFTMLAFVIKAVVGALKKFPTFNASLDGDNLV
FKQYFHIGFAADTPNGLVVPVIRDADKKGLIDIAKEMADLSKAAREGKLKPDQMQGGCFS
ISSLGGIGGTHFTPIINAPEVAILGLSRGYQKPVWDGKQFVPRLTLPLSLSYDHRVIDGA
EAARFNAYLASVLADFRRVSL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtcgtagaaatcaaggtgccggacatcggcgactacaaagacgtcccggtg
atcgaagtgctggtcaaggcgggcgataccgtcaacgccgaggattcgctggtcacgctg
gaatcggacaaggcgaccatggacgtgccctcgcccaagagcggcgtcgtcaaggaagtg
aagatcaaagtgggtgacaccgtgtcggaaggctcgctggtgctgctgctcgaagagcag
ggcgctgctgccgcaccggccccggcacctcaagctgcgcccgcaccggctccgaccgct
gctgcaccggcacccgcaccggtcgcgcaagctccggccgctgcgccggctgccgctggc
ggcggcacgatcgaagtgaaagtgccggacatcggcgactacaccgacgtgccggtcatc
gagatcagcgtgaaggtgggcgacaaggtggaagccgagcagtccctgatcacgctggag
tcggacaaggccacgatggatgtgccgtcgccggccgccggtaccgtcaaggacatccgc
gtgaaggtgggcgatgccgtgtcgcaaggcacgctgatcgtcgtgctggagggtgctggc
ggtgctgccgctgcgccggcacctgcgcaagccccggtaccggcacccacagccgcaccg
gcggccgctgcaccgagcccggcccctgcggctgcgcccgcagctgctccggccgcagcg
cccgctacatacaccgccgacaccgtcggtacagtgggcaaggcggcccacgccagcccc
tcggtgcgcaagtacgcgcgtgaactgggcgtgaacgtcaacctggttggcggcaccggt
ccgaagaaccgtatcacgcaggaagacgtgcagcgctacgtcaagagcgtgatgagcggc
caggccgctgcgccgggcaaggctgccgcaactgcgccggccggcggtggcgagctgaac
ctgctgccgtggccgaaggtggacttcaccaagttcggcccggtcgatccgaagccgctg
tcgcgcatcaagaagatttcgggtgcgaacctgcaccgcaattgggtcatgatcccgcac
gtcacgaacaatgacgaagcggacatcaccgagctggaagccttccgcgtgcagatgaac
aaggaccacgaaaaggccggcgtgaaattcacgatgctggcgttcgtgatcaaggcagtc
gtgggtgcgctgaagaagttcccgaccttcaacgcgagcctggacggcgacaacctggtc
ttcaagcagtatttccacatcggctttgcggctgatacgcccaacgggctggtggtgccg
gtgatccgcgatgcggacaagaaggggctgatcgacatcgccaaggaaatggcggacctc
tcgaaggctgcgcgcgaagggaaactcaagccggaccagatgcagggcggctgcttctcg
atctcgtcgctgggcggtattggcggcacgcatttcacgccgatcatcaacgcaccggaa
gtggccatcctcggcctgtcgcgcggttatcagaagccggtgtgggacggcaagcagttc
gtgccgcgcctgacgctgccgctgtcgctgtcgtacgatcaccgcgtgatcgacggcgcc
gaggctgcgcgcttcaacgcgtatctggccagcgtgctggcggacttccgccgcgtcagc
ctgtaa

DBGET integrated database retrieval system