KEGG   Ralstonia pickettii 12D: Rpic12D_1651Help
Entry
Rpic12D_1651      CDS       T00925                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Rpic12D_1651
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Rpic12D_1651
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Rpic12D_1651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1755285..1756064)
Genome map
AA seq 259 aa AA seqDB search
MLQGKTALVTGSTSGIGLGIACSLAAQGANIIMNGFGDVEAPKAQIAAAGKNAIRIGYHG
ADMSKPAEIEAMFAYADAEFGGVDILVNNAGIQYVANVEDFPTERWDAIIAINLTSAFHT
TRLAVPGMKRKNWGRIINVASVHGLVASAQKSAYVAAKHGIVGFTKSVALETAQTGITSN
AICPGWVLTPLVQKQIDARAEKDGLSALEAKTDLLMEKQPSREFVTPDQLGALAVFLCSD
AAEQVRGVAWNMDGGWVAQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaggaaaaaccgccctcgtcacgggctcgaccagcgggattggtctgggtatt
gcctgttcgctggccgcgcagggcgccaacatcatcatgaatggctttggcgatgtggaa
gcacccaaggcgcagatcgcggccgcgggcaaaaatgccatccgcatcggatatcacggc
gccgacatgagcaagccagccgagatcgaagcgatgttcgcctatgccgacgcagagttt
ggcggcgtggacatcctcgtcaacaacgccggcatccagtatgtggccaatgtcgaggat
ttcccgaccgaacgctgggacgccatcatcgccatcaacctcacctcggctttccacacg
acgcggcttgctgtgccgggcatgaagcgcaagaactggggccgcatcatcaacgtcgca
tcggtgcatgggttggtggcatcggcgcagaaatcggcgtacgtggcggccaaacacggt
atcgtcggcttcaccaaatcggtggcgctggagaccgcacagacgggcatcacgtccaac
gcgatctgcccgggctgggtgctgacgccgctcgtgcagaagcagatcgatgcgcgcgcc
gagaaggacggcctgtccgcgctcgaagccaagacagatctgctgatggaaaagcagcct
tcgcgtgagttcgttacgcccgatcaactcggcgcgctggcagtcttcctgtgcagcgat
gcggctgagcaggtgcgcggcgtggcgtggaacatggatggcggctgggtcgcgcagtaa

DBGET integrated database retrieval system