KEGG   Ralstonia pickettii 12D: Rpic12D_1735Help
Entry
Rpic12D_1735      CDS       T00925                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rpf  Ralstonia pickettii 12D
Brite
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Rpic12D_1735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1847188..1847640)
Genome map
AA seq 150 aa AA seqDB search
MSTEHNPRTTGERGLALIKESEGLRLSTYLDAVGKPTIGYGHLIRPGETFNGPISQQQAE
ALLRKDLADTEQGIAKAVRVSITQGQFDALASFVFNLGAGRLRSSTLLRKLNAGDYAGAA
NQFLLWDKAGGKPLKGLTKRRQAERKLFLS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgagcacaacccgcgcaccaccggcgagcgaggcctcgcgctgatcaaggaa
tcggaaggactgcgtctgtcgacgtatctggatgcggtcggtaagccgaccatcggctac
ggccatttgatccggcctggcgagaccttcaacgggccgatctcgcagcagcaggccgaa
gcgctgctgcgcaaagacctggccgacaccgagcagggcattgccaaggccgtgcgcgtg
tcgattacgcaaggtcaattcgacgcactggcgtcctttgtcttcaacctgggggcgggg
cggcttcgctcttcaacgctgctgcgcaagctcaacgcgggcgactacgccggcgcggcc
aatcagttcctgctgtgggacaaggccggcggcaagccgctcaaaggactgacgaagcgc
cgccaggccgaacgcaagttgttcctgtcctga

DBGET integrated database retrieval system