KEGG   Ralstonia pickettii 12D: Rpic12D_1826Help
Entry
Rpic12D_1826      CDS       T00925                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00020  Citrate cycle (TCA cycle)
rpf00190  Oxidative phosphorylation
rpf00650  Butanoate metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
rpf01200  Carbon metabolism
Module
rpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpic12D_1826
   00650 Butanoate metabolism
    Rpic12D_1826
  Energy metabolism
   00190 Oxidative phosphorylation
    Rpic12D_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ACS63108
JGI: Rpic12D_1826
UniProt: C6BJI5
Position
1:complement(1945246..1945611)
Genome map
AA seq 121 aa AA seqDB search
MANNNIGPKRLVVGAHYGLKDFLAQRVTAVIMAVYTIVLLAAFLLSKDTSYQSWAGLFSN
QWMKMLTFLAFVSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataacaatatcggtcccaagcgcctcgtcgtcggcgcgcactacggtctgaag
gacttcctcgcgcagcgtgtcaccgcggtgatcatggcggtctacaccatcgtgttgctg
gctgcattcctgctctcgaaagacacgtcgtaccaaagctgggcggggctgttctccaac
cagtggatgaagatgctgacgttcctggcgttcgtgtcgctcacgtatcacgcctggatc
ggtgtgcgtgacatctggatggactacgtgaagcccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgtgcgggctacgcagctcagattctctggagg
gtttaa

DBGET integrated database retrieval system