KEGG   Ralstonia pickettii 12D: Rpic12D_1893Help
Entry
Rpic12D_1893      CDS       T00925                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic12D_1893 (tpiA)
   01230 Biosynthesis of amino acids
    Rpic12D_1893 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_1893 (tpiA)
   00051 Fructose and mannose metabolism
    Rpic12D_1893 (tpiA)
   00562 Inositol phosphate metabolism
    Rpic12D_1893 (tpiA)
Enzymes [BR:rpf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rpic12D_1893 (tpiA)
Exosome [BR:rpf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rpic12D_1893 (tpiA)
  Exosomal proteins of bladder cancer cells
   Rpic12D_1893 (tpiA)
  Exosomal proteins of melanoma cells
   Rpic12D_1893 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2009532..2010278)
Genome map
AA seq 248 aa AA seqDB search
MNARPKLVVGNWKLHGSLSTNAALLEQIKAAGKTAATLAVCAPFPYLAQCQSLLAGSAVA
WGAQDVSAEARGAFTGEVAASMLSEFGCGYVIVGHSERRSYHGETDAQVAAKALRALEHG
ITPIVCVGETLAQREAGETEQVVGRQLDAVLEALSVEQLGRIVVAYEPVWAIGTGKTASS
EQAQAVHAFLRARVAARDAGVAQRLAILYGGSVKPDNAGELFAMADIDGGLIGGASLKAE
DFLAIGRA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcaagaccgaagctggtggtggggaactggaagctgcatggcagcctgagcacg
aacgccgcgctgcttgagcagatcaaggccgcaggcaaaaccgccgccacgctggcggta
tgtgcgccgtttccgtacctggcgcagtgccagtcgctgctcgccggttctgcggtggca
tggggtgcacaggatgtttcggctgaagcgcgcggcgcctttacgggcgaagtggcggcg
tcgatgttgtcggaattcggttgcggctacgtgatcgttgggcactccgagcgtcggtcg
taccacggtgaaaccgacgcgcaagtggcggccaaggccctgcgcgcgctcgaacacggc
atcacaccgatcgtctgtgtgggcgaaacgcttgcgcagcgcgaagccggtgagaccgag
caggtggtgggccggcaactggatgcggtgctggaggcgctgtcggtggagcaactgggt
cgtattgttgtggcttacgagccggtctgggccatcggcacaggcaagaccgcatccagc
gagcaggcgcaggctgtgcatgcgttccttcgagcgcgcgtcgccgcccgtgacgctggt
gtggcgcagcgcctggcaattctgtatggcggaagcgtcaagcccgacaatgccggcgaa
ctgtttgcaatggcggacatcgatggtggcctgatcggcggcgcctccctgaaggccgaa
gatttcctggcgatcggtcgcgcataa

DBGET integrated database retrieval system