KEGG   Ralstonia pickettii 12D: Rpic12D_1943Help
Entry
Rpic12D_1943      CDS       T00925                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K03841  
fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic12D_1943
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_1943
   00030 Pentose phosphate pathway
    Rpic12D_1943
   00051 Fructose and mannose metabolism
    Rpic12D_1943
  Energy metabolism
   00680 Methane metabolism
    Rpic12D_1943
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Rpic12D_1943
Exosome [BR:rpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpic12D_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2070100..2071116
Genome map
AA seq 338 aa AA seqDB search
MKRINLTRYLIEEQREHNTIPAELRLLLEVVARACKAISHSVNKGALAGVLGSAGTGNVQ
GETQQKLDVIANEVLLEANEYGGNLAAMASEEMESFYEIPHRYPKGEYLLLFDPLDGSSN
IDVNVSIGTIFSVLHMPQAGQAVTEADFLQPGAKQVAAGYAVYGPQTTLVLTVGNGVHMF
TLDREVGSFVLTSRDVKIPVDTKEFAINMSNMRHWAPPVRRYIDECLAGTEGPRGKDFNM
RWIASMVADVHRILTRGGIFMYPWDKREPGKAGKLRLMYEANPMAFLVEQAGGAATNGEQ
RILDIQPEQLHQRVAVVLGSKNEVDRVTQYHLEAKKTA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcatcaacctcacccgctacctgatcgaagagcagcgcgagcacaacaccatc
ccggccgagctgcgtctgctgcttgaagtcgtggcgcgcgcctgcaaggcgatctcgcac
agcgtcaacaagggggcccttgccggcgtgctcggctcggccggcaccggcaacgtgcaa
ggcgaaacccagcagaagctggacgtgatcgccaacgaagtcctgctcgaagccaacgaa
tacggcggcaacctggccgccatggcctcggaagaaatggaatcgttctacgagattccg
caccgctatccgaagggcgaatacctgctgctgttcgatccgctcgacggctcgtccaac
atcgatgtgaacgtatcgatcggcacgatcttctcggtgctgcacatgccccaagcgggc
caggctgtgaccgaagccgatttcttgcagccgggggcaaagcaggttgccgccggttac
gccgtgtacggcccgcagaccacgctggtgctgacggttggcaatggcgtgcacatgttc
acgctcgaccgtgaagtcggcagcttcgtgctgaccagccgcgacgtgaagattccggtc
gacacgaaggaattcgccatcaacatgtcgaacatgcgccactgggccccgcccgtgcgc
cgctacatcgacgagtgcctggccggcaccgaaggcccgcgcggtaaggacttcaacatg
cgctggatcgcctcgatggtggccgacgtgcatcgcatcctcacgcgcggcggcatcttc
atgtacccgtgggacaagcgcgagccgggcaaggccggcaagctgcgcctgatgtacgag
gccaatccgatggccttcctggtggaacaggccggcggcgcggccaccaatggcgagcaa
cgcattctggatatccagcccgaacagctgcaccagcgtgtggcggtcgtcctcgggtcg
aagaacgaggtggatcgcgtcacgcaatatcacctcgaggccaagaagacggcgtaa

DBGET integrated database retrieval system