KEGG   Ralstonia pickettii 12D: Rpic12D_1956Help
Entry
Rpic12D_1956      CDS       T00925                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rpf00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2081281..2081946)
Genome map
AA seq 221 aa AA seqDB search
MPSSQAHSAVDTPIENHFPGSLFMVVAPSGAGKSTLVNALLAHDSSIRLSVSATTRKPRP
GEQHGREYNFMTVEEFKACRDRGEFLEWAEVHGNYYATSRVWIEEQMRAGTDVLLEIDWQ
GAQQVHRRFANAVEIFILPPSLTALEDRLKKRGQDEPNVIVRRLLAAGSEMAHAPEADYV
IINEVFDTALAELRTVVQATRLRFGAQKARHGELFVELGIH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccatcctctcaagcgcactctgccgtcgatacgcccatcgagaatcactttccgggc
agcctgttcatggtcgtcgcaccgtcgggcgccggtaagtcgacgctggtgaatgcgctg
ctggcgcacgattcgtcgattcgcctgtcggtttcggccaccacgcgcaagccgcgtccg
ggcgagcagcacggccgcgagtacaacttcatgaccgtcgaggagttcaaggcttgccgt
gatcgcggcgagtttctcgaatgggcagaggtgcacggcaactactacgccacttcgcgc
gtgtggatcgaagaacagatgcgcgccggtaccgacgtgttgctcgaaatcgactggcag
ggcgcgcagcaggtgcatcgccgtttcgccaatgccgtagagatcttcattctgccgccg
tcgctcacggcgctggaggatcgtctgaagaagcgcggccaggacgagccgaacgtgatc
gtgcgccgcctgctcgcagcgggctccgagatggcgcacgcgcccgaggccgactacgtg
atcattaacgaagtgttcgacacggcattggccgagctgcgcaccgtggtgcaggccacg
cgcctgcgcttcggtgcccagaaggcgcgccacggtgagctctttgtcgaactgggcatt
cactga

DBGET integrated database retrieval system