KEGG   Ralstonia pickettii 12D: Rpic12D_1956Help
Entry
Rpic12D_1956      CDS       T00925                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00230  Purine metabolism
rpf01100  Metabolic pathways
Module
rpf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rpic12D_1956
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Rpic12D_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase MMR_HSR1 ABC_tran AAA_16 AAA_25 AAA_29 AAA_22 Septin AAA_18 AAA_23 cobW AAA_30 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ACS63236
JGI: Rpic12D_1956
UniProt: C6BJZ1
Position
1:complement(2081281..2081946)
Genome map
AA seq 221 aa AA seqDB search
MPSSQAHSAVDTPIENHFPGSLFMVVAPSGAGKSTLVNALLAHDSSIRLSVSATTRKPRP
GEQHGREYNFMTVEEFKACRDRGEFLEWAEVHGNYYATSRVWIEEQMRAGTDVLLEIDWQ
GAQQVHRRFANAVEIFILPPSLTALEDRLKKRGQDEPNVIVRRLLAAGSEMAHAPEADYV
IINEVFDTALAELRTVVQATRLRFGAQKARHGELFVELGIH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccatcctctcaagcgcactctgccgtcgatacgcccatcgagaatcactttccgggc
agcctgttcatggtcgtcgcaccgtcgggcgccggtaagtcgacgctggtgaatgcgctg
ctggcgcacgattcgtcgattcgcctgtcggtttcggccaccacgcgcaagccgcgtccg
ggcgagcagcacggccgcgagtacaacttcatgaccgtcgaggagttcaaggcttgccgt
gatcgcggcgagtttctcgaatgggcagaggtgcacggcaactactacgccacttcgcgc
gtgtggatcgaagaacagatgcgcgccggtaccgacgtgttgctcgaaatcgactggcag
ggcgcgcagcaggtgcatcgccgtttcgccaatgccgtagagatcttcattctgccgccg
tcgctcacggcgctggaggatcgtctgaagaagcgcggccaggacgagccgaacgtgatc
gtgcgccgcctgctcgcagcgggctccgagatggcgcacgcgcccgaggccgactacgtg
atcattaacgaagtgttcgacacggcattggccgagctgcgcaccgtggtgcaggccacg
cgcctgcgcttcggtgcccagaaggcgcgccacggtgagctctttgtcgaactgggcatt
cactga

DBGET integrated database retrieval system