KEGG   Ralstonia pickettii 12D: Rpic12D_2165Help
Entry
Rpic12D_2165      CDS       T00925                                 

Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rpf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2303181..2305178)
Genome map
AA seq 665 aa AA seqDB search
MLVAALERHGLRTHQFPLLDIAPTPNLDDLRAALGDPSRYALVVFVSPNAVQQAFAAMPE
GFRWPQEVPVAVVGPASAQALATHGVAPPAYRVIKPDTHAGDARQDSEALYARLDVPSLS
GREVLIVRGNGGREWLADQLREAGASVRTAEAYRRSVPVPDAAAWLALRAVLSSRHAWTL
TSSEAVRNLDELARANLSPADLDTLHGAPCFASHARIVEQAESLGFRDVTLTGAGDDRLL
ASVLAWAGPIWAPEHAPATVPDDSNPSTSSSTVTQTPVPSSAPAPASTPAPAAVKPSPAP
AAPPAAFAPTMTVNHAPRRGGWIIWVALVAVVAAVAALQVRNERLAREIRQRAQTNEALA
QEMRVLSRADQDSVSQLQQKFGALDARTAETRDRQAALEQANQDLLRNRDDWQRAEIQRS
LEVTAEQLQLTGNVAGALAALQTIDARLATLDKPQFNAVRRAVSRDMAKLKAMPSFDLAG
AALRLDDAINAVDTLPLVSSAQPLEAEQAAQAPHTVAKPSKNAKAHAASAPVASTPPNAG
WSAGVRAWWGRLWNDVRGELGQIVQVRRVDQTEALLLSSDQAWFLRENLKLRLMNARLAL
LSRNEAVFRADLGRADTLLARYFDTQSSRVTTVQNQLSQVRAMVGTLQVPTLADSLAAVR
GSGKE
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctggtggctgcgcttgagcgccacggcctgcgcacgcaccagtttccgctgctcgac
attgcgccgacgcccaatctcgacgacttgcgtgccgcgttgggtgatccttcgcgctat
gcgctcgtcgtgttcgtgagtcccaacgccgtgcagcaggcatttgccgccatgccggaa
ggcttccgctggccgcaggaagtgccggtggcagtagtggggcccgcgagcgcacaagcg
cttgccacgcacggcgttgcgccgcccgcgtaccgcgtgatcaagcccgacacgcatgcc
ggcgacgcccgccaggattccgaggcgttgtacgcgcggctggatgtgccttcgctcagt
ggccgtgaagtgttgatcgtgcgcggcaacggtggccgtgagtggctggccgatcagctg
cgcgaagccggtgcatcggtccgtacggcggaagcctatcgccgcagcgtaccggtgccc
gatgccgctgcgtggcttgcgttgcgtgccgtgctttcgtcccgccacgcctggacgctc
accagctccgaggccgtccgcaatcttgatgagctggcccgcgccaatctgtcgcccgct
gatctcgatacgctgcacggcgcgccatgctttgcttcgcacgcccgcatcgtcgaacag
gccgaatcgctgggtttccgcgatgtgacgctgaccggcgccggcgacgaccggctcctc
gccagcgtgctcgcctgggccgggccgatatgggctcccgagcatgccccagcaacggtg
ccggatgattcaaacccgtctacttcttcttccactgtgacgcagactcccgttccctcg
tccgctccggctcccgcttcaacgccagcgcccgcagccgtcaagccgagtcctgcgcct
gctgctccgccggctgcgtttgcgcccaccatgacggtcaaccatgcgccgcgccgtggc
ggttggatcatctgggtggcgctggtcgcggtcgtggcggcagtggccgcgctacaggtg
cgcaacgaacgccttgcacgcgagatccgtcagcgcgcccaaacgaacgaggcgctggcg
caggagatgcgcgtgctgtcgcgtgcggatcaggattcggtttcccaactgcagcagaag
ttcggcgcactggatgcccgcactgcggaaacgcgcgatcgccaggccgccctcgagcag
gccaaccaagaccttctgcgcaaccgcgatgactggcagcgcgccgagatccagcgttcg
ctggaagtgaccgctgaacaactgcaactgaccggcaacgtcgcgggtgcattggctgcg
ctgcaaacgatcgacgcgcgcctggccacgctcgacaagccgcagttcaacgccgtgcgt
cgggcggtatcgcgcgacatggccaagctcaaggcgatgccgtcgtttgatctggccggt
gctgcgctgcggttggatgacgccatcaacgcggtcgatacgctgccgctcgtctcgtcg
gcccagccgctggaggcggaacaggctgcgcaggcgccgcatactgtggcgaaaccctcg
aagaatgccaaggcacacgctgcgtcggcgcccgttgcctcgacgccgccaaacgccgga
tggtcggcaggcgtgcgcgcttggtggggccgcctgtggaacgacgtgcgcggcgaactc
ggccagatcgtacaggtgcgccgcgtcgatcagaccgaggcactgctgctgtcttccgac
caagcgtggttcctgcgcgaaaacctcaagctgcgcctgatgaatgcgcgcctggcgttg
ctctcgcgcaatgaagccgtgttccgcgccgatctcggtcgcgccgatacgctgctcgca
cgctacttcgatacgcaatcttcgcgcgtgaccacggtgcagaatcagctctcgcaagtg
cgcgcgatggttggcacgctgcaagtgccgacgctggccgacagccttgccgccgtgcgc
ggttcgggcaaggagtga

DBGET integrated database retrieval system