KEGG   Ralstonia pickettii 12D: Rpic12D_2218Help
Entry
Rpic12D_2218      CDS       T00925                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00230  Purine metabolism
rpf00240  Pyrimidine metabolism
rpf01100  Metabolic pathways
rpf03030  DNA replication
rpf03430  Mismatch repair
rpf03440  Homologous recombination
Module
rpf_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rpic12D_2218
   00240 Pyrimidine metabolism
    Rpic12D_2218
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Rpic12D_2218
   03430 Mismatch repair
    Rpic12D_2218
   03440 Homologous recombination
    Rpic12D_2218
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Rpic12D_2218
DNA replication proteins [BR:rpf03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Rpic12D_2218
DNA repair and recombination proteins [BR:rpf03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Rpic12D_2218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi DUF1590
Motif
Other DBs
NCBI-ProteinID: ACS63492
JGI: Rpic12D_2218
UniProt: C6BBN6
Position
1:complement(2363830..2364258)
Genome map
AA seq 142 aa AA seqDB search
MTRVDFHSNVPGKLAYACRLVRKAYGAGQKVIVVGDQVALEAFDTQLWTFSPLDFLPHCG
LRHSLAAQTPILLADATEPLDDAPHHDILVNLSPEPPALFARFSRLIEIVGDDDADRAAA
RDRFRFYRDRGYPIQHHDVGRA
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgtcgatttccacagcaatgtgcccggcaagctggcgtacgcatgccggctc
gtgcgcaaggcctacggcgcgggccagaaggtgatcgtggtcggagatcaggttgcgctg
gaagcgttcgacacgcagttgtggaccttcagtccgctcgatttcctgccgcactgcggt
ctgcggcattccctggctgcgcagacgccgatcctgctggctgatgcaaccgagcctctg
gacgacgccccacatcacgacatcctggtcaacctctctcctgagccgccggcgctgttc
gcgcgcttcagccggttgatcgagatcgtcggcgatgacgatgccgaccgcgccgccgcg
cgcgatcgcttccgtttctaccgcgatcgcggttatccgatccaacaccacgacgtgggg
cgcgcatga

DBGET integrated database retrieval system