KEGG   Ralstonia pickettii 12D: Rpic12D_2602Help
Entry
Rpic12D_2602      CDS       T00925                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
rpf  Ralstonia pickettii 12D
Brite
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Rpic12D_2602
Transfer RNA biogenesis [BR:rpf03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Rpic12D_2602
 Prokaryotic Type
    Rpic12D_2602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2740489..2740920)
Genome map
AA seq 143 aa AA seqDB search
MTKRLGAWIGRSVSQAMARGALAATLAMSVAGLPGDAVARDNSGMAAAVGTIRAADLPNE
AQRTLALIEQGGPFPYAKDGITFGNYERRLPAQRRGYYHEYTVKTRGARNRGARRIICGG
DQQAANDCYYTEDHYNSFQRIQR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcgacttggagcgtggatcggccgctccgtatctcaggcgatggcacgtggc
gcgctggcggcgacgcttgcgatgtcagtggcaggcttgccgggcgatgcggtcgcccgg
gacaactccggcatggcggccgccgtgggaaccattcgcgcggcagacctgcccaatgag
gcgcagcgcacgctggcactgatcgagcagggcggcccgttcccctatgcaaaagatggc
atcacgttcggcaactatgagcgacgtttgcctgcgcagcggcgtggctattaccacgag
tacaccgtgaagacgcggggggctcgtaaccgcggcgcccggcgcattatctgcggcggg
gatcagcaagcggccaacgactgctactacacggaagatcactacaacagttttcaacgg
atacagcgatga

DBGET integrated database retrieval system