KEGG   Ralstonia pickettii 12D: Rpic12D_2749Help
Entry
Rpic12D_2749      CDS       T00925                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00071  Fatty acid degradation
rpf00280  Valine, leucine and isoleucine degradation
rpf00281  Geraniol degradation
rpf00310  Lysine degradation
rpf00360  Phenylalanine metabolism
rpf00362  Benzoate degradation
rpf00380  Tryptophan metabolism
rpf00410  beta-Alanine metabolism
rpf00627  Aminobenzoate degradation
rpf00640  Propanoate metabolism
rpf00650  Butanoate metabolism
rpf00903  Limonene and pinene degradation
rpf00930  Caprolactam degradation
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
rpf01212  Fatty acid metabolism
Module
rpf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpic12D_2749
   00650 Butanoate metabolism
    Rpic12D_2749
  Lipid metabolism
   00071 Fatty acid degradation
    Rpic12D_2749
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpic12D_2749
   00310 Lysine degradation
    Rpic12D_2749
   00360 Phenylalanine metabolism
    Rpic12D_2749
   00380 Tryptophan metabolism
    Rpic12D_2749
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpic12D_2749
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rpic12D_2749
   00281 Geraniol degradation
    Rpic12D_2749
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpic12D_2749
   00627 Aminobenzoate degradation
    Rpic12D_2749
   00930 Caprolactam degradation
    Rpic12D_2749
Enzymes [BR:rpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rpic12D_2749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ACS64020
JGI: Rpic12D_2749
UniProt: C6BEK8
Position
1:complement(2914084..2914860)
Genome map
AA seq 258 aa AA seqDB search
MSYENILVETRGRVGLITLNRPKALNALNDALMDELGAALLAFDADANIGAIVITGSEKA
FAAGADIGAMADYDFATVYKNEYITRNWETIRRIRKPVIAAVAGYALGGGCELAMMCDII
LAADTARFGQPEIKLGTMPGAGGTQRLPRAVSKAKAMDLCLTARMMGAEEAERAGLVSRV
IPADKLLDEAIQAAETIAGFSLPTVMMIKESINAAYETSLSEGVHLERRLFHSTFATEDQ
KEGMRAFIEKRAPAFKHQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgaaaacattctggtcgaaacgcgcggccgcgtcggtcttattacgctcaat
cgtccgaaggcgctcaatgccctcaacgatgcgctgatggatgaacttggcgccgcgctg
cttgcctttgatgccgacgccaacattggcgccattgtcattaccggcagtgaaaaggcg
ttcgccgccggcgcggatatcggcgccatggccgattacgacttcgctaccgtctacaag
aacgaatacatcacgcgcaactgggaaaccattcgccgcatccgcaagccggtgatcgcc
gcggtggccggctacgcgctcggtggcggctgtgaactggccatgatgtgcgacatcatc
ctcgccgccgataccgccaggttcggccagccggaaatcaagctcggcaccatgcccggc
gcaggcggcacgcagcgcctgccgcgcgcagtctccaaagccaaggccatggacctctgc
ttgacggcccgcatgatgggcgccgaggaagccgagcgcgcgggcctggtctcgcgcgtc
atccccgccgacaagctgctcgacgaagcgatccaggcggcagaaaccattgccggcttc
tcgctgcccacggtcatgatgatcaaagagtcgatcaacgcggcctacgagacctcgctc
agcgaaggcgtccatctggagcgccgcctgttccattccacgtttgccaccgaagatcag
aaagagggcatgcgcgccttcatcgagaagcgtgcgcccgcgttcaagcaccaataa

DBGET integrated database retrieval system