KEGG   Ralstonia pickettii 12D: Rpic12D_2762Help
Entry
Rpic12D_2762      CDS       T00925                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01130  Biosynthesis of antibiotics
rpf01230  Biosynthesis of amino acids
Module
rpf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rpic12D_2762
Enzymes [BR:rpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Rpic12D_2762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C DUF3277
Motif
Other DBs
NCBI-ProteinID: ACS64033
JGI: Rpic12D_2762
UniProt: C6BEM1
Position
1:2925183..2925986
Genome map
AA seq 267 aa AA seqDB search
MSDILQKILAVKAEEVAAARKHRDLPSVRAEAEANRTDSTLGARGFAKAMRDKIAAGNAA
IIAEVKKASPSKGVLRPNFKPADIARSYAEYGAACLSVLTDEQFFQGHADYLREARAACT
LPVLRKDFMVDLYQVYEARSWGADCILLIVAALDQGLMEELEACALELGMDVLVEVHDGH
ELDRALRLQTPLVGVNNRNLRTFETSLDNTLGLLKHMPDDRIVVTESGILTPDDVRKMRA
AAVNAFLVGEAFMRADDPGAELARLFA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctgcagaaaatcctggccgtgaaggccgaagaagtggccgccgcgcgc
aagcaccgcgacctgcccagcgtgcgcgccgaagccgaagccaaccgcaccgacagcacg
ctcggcgcccgcggctttgccaaggcaatgcgcgacaagatcgccgccggcaacgcggcg
atcatcgccgaagtgaaaaaggcgtcgccgtccaaaggcgtgctgcgcccgaacttcaag
cccgccgacatcgcccgcagctatgccgagtacggcgccgcgtgcctctccgtcctgacc
gacgagcagttctttcaaggccacgccgattacctgcgcgaagcccgcgccgcctgcacg
ctgccggtgctgcgcaaggatttcatggtcgacttgtaccaggtgtacgaagcgcgctca
tggggcgcggactgcatcctgctgatcgtggccgcgctggatcagggcctgatggaagaa
ctcgaagcgtgcgcgctggaactcggcatggacgtgctggtagaagtgcacgacggccac
gaactggaccgcgcgctgcgtctgcaaacgccgctggtgggcgtgaacaaccgcaacctc
cgcacgttcgagacgtcgctcgacaacactctcggcctgctcaagcacatgccggacgat
cgcatcgtcgtcacggaatccggcatcctcacgccggacgacgtgcgcaagatgcgcgcc
gccgccgtcaacgcgttcctcgtcggcgaagccttcatgcgtgcagacgacccgggcgcc
gaactggcccgcctgttcgcctga

DBGET integrated database retrieval system