KEGG   Ralstonia pickettii 12D: Rpic12D_2768Help
Entry
Rpic12D_2768      CDS       T00925                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rpf  Ralstonia pickettii 12D
Brite
Enzymes [BR:rpf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Rpic12D_2768
Secretion system [BR:rpf02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Rpic12D_2768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2933090..2933836)
Genome map
AA seq 248 aa AA seqDB search
MSFRIRVAAIASAVAVAAIGAGYVLSAGAAEPALDKVKATVQKALGPNVEIKSVAKSPLA
GLYEINLGSQVVYSDATGRYVLNGDLLDTQTATNLTQERLAELNRVKWSDLPLDRAVKWV
KGNGARKIAVFSDPNCPYCHKLEQMLTQVDNVTVYTFLFPILSEDSNTKAKQIWCSADRA
KAWRDWMTAKTAPGGAGTCDTPLEANLKLGQQLNVTGTPAIIFPDGSRAPGLIDAATLER
KFAALKKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcgtattcgggtggcggccatcgcctctgcggtggctgttgcggccattggc
gcgggctatgtcttgagcgccggtgccgccgagcccgccttggacaaggtcaaggccacc
gtacagaaggccctgggcccgaacgtggagatcaagagcgtcgccaagtcgccgctcgcg
ggcctgtacgagatcaacctcggcagccaggtcgtctacagcgatgccaccggccgctac
gtgctcaacggcgacctgctcgacacacagaccgccaccaacctcacgcaggagcgcctg
gccgagttgaaccgcgtgaagtggtccgacttgccgctggaccgcgccgtgaagtgggtc
aagggcaacggcgcacgcaagatcgccgtattctccgatccgaactgcccgtactgccac
aagctggaacagatgctgacgcaggtcgacaacgtcacggtctacaccttcctgttcccg
atcctgtcggaggactcaaacaccaaggccaagcagatctggtgctcggccgaccgcgcc
aaggcttggcgcgactggatgaccgccaagaccgccccgggcggcgccggcacctgcgat
acaccgctcgaggccaacctgaagctcggccagcaactgaacgtgaccggcacgccggcc
atcatcttcccggatggctcgcgggcgccgggcctgatcgatgcggccacgctggagcgc
aagttcgccgcgctcaagaagtcgtaa

DBGET integrated database retrieval system