KEGG   Ralstonia pickettii 12D: Rpic12D_2987Help
Entry
Rpic12D_2987      CDS       T00925                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rpic12D_2987
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rpic12D_2987
Exosome [BR:rpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpic12D_2987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3150430..3151926
Genome map
AA seq 498 aa AA seqDB search
MEYLLALDQGTSSSRAIVFNRAGQIVASAQQEFPQHFPQPGWVEHDPFDIWNSQLATCRA
ALEQAKLTAADMAALGITNQRETTMVWERATGKPIFNAIVWQDRRTEAICERLRAEGLED
EVRKRTGLIIDPYFSATKLRWILDHVDGARERAARGELAFGTIDSWLVWQLTRGRLHVTD
VSNASRTMLWNIHTGEWDADLMRALDIHPSLLPEVHPSAYQFGQTDADWLGASLTIGGIA
GDQQSALFGQACFKPGMAKNTYGTGCFMLLNTGDKAVQSHNGLISTAACQSGTKRSYALE
GSVFVGGAVVQWLRDGLRAIQRSADVEGLAASVPDSGGVVFVPSFTGLGAPYWDPTAQGA
IVGLSRGTTIGHIARAALESIAFQSTALLQAMTRDAVSTISELRVDGGASANNLLLQFQA
DLLGIPVVRPEIIETTALGAAYLAGIATGFYRDEAEVAQQWRASRTFHPVISRDEAAHRI
AQWEMAVAQVRLPTARAH
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaatacctcctcgcgctcgaccagggcacgtccagctcacgcgccatcgtcttcaac
cgcgccggccagatcgtcgccagtgcccagcaggagtttccgcagcatttcccgcagccc
ggctgggtcgagcatgacccgttcgacatctggaacagccagctcgccacctgccgcgcc
gcactcgaacaagccaagctgaccgctgccgacatggccgcgcttggcatcaccaaccaa
cgcgaaaccaccatggtgtgggagcgcgccactggcaaaccgatcttcaacgccatcgtc
tggcaggaccgccgcaccgaagccatctgcgaacgcctgcgcgccgagggcctggaagac
gaggtgcgcaagcgcaccggcctgatcatcgatccgtatttttcggccaccaagctgcgc
tggattctcgaccacgtggacggcgcccgcgagcgcgcggcgcgtggcgaactcgccttc
ggcaccatcgacagctggctcgtgtggcagctcacgcgcggccgcctccatgtgaccgac
gtgtcgaacgcttcccgcacgatgctgtggaacatccacacgggcgaatgggatgcggac
ctgatgcgcgcgctggacattcacccgagcctgttgcccgaggtgcatccgtctgcgtac
cagtttgggcagaccgatgcggactggctcggcgcttcgctcaccatcggcggcattgcc
ggcgaccagcaatcggcgctcttcggccaggcctgcttcaagccgggcatggccaagaac
acctacggcaccggctgtttcatgttgctcaacacgggcgacaaagcggtccagtcgcac
aacggcctcatcagcacggcggcatgccagagcggcacgaagcgcagctatgcgctcgaa
ggcagtgtgtttgtgggcggcgcggtcgtgcagtggctgcgcgacggcctgcgcgcgatc
cagcggtccgccgacgtcgaagggctggccgcctcggtgcccgattccggaggtgtggtg
ttcgtgccgtcgttcacaggcctgggtgcgccgtactgggaccctaccgcacaaggcgcc
atcgtcggcctgtcacgcggcaccaccatcggccacatcgctcgtgcggcactcgaatcc
atcgccttccaaagcacggcactgctgcaggccatgacgcgcgatgccgtttccaccatc
tcggaactgcgcgtcgatggcggtgcctcggccaacaacctgctgctgcagttccaggca
gatttgctgggtattccggtggtgcgcccggagatcatcgagacgacggcgctcggcgcg
gcttacctggcgggcatcgcaaccggcttctatcgtgatgaagcggaagtcgcccagcaa
tggcgtgcctcgcgcacgttccacccggtcatcagccgcgacgaggcggcgcatcgcatc
gcccagtgggaaatggccgtcgcgcaggtccgcctgccgaccgcgcgtgctcactga

DBGET integrated database retrieval system