KEGG   Ralstonia pickettii 12D: Rpic12D_2987Help
Entry
Rpic12D_2987      CDS       T00925                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rpf00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3150430..3151926
Genome map
AA seq 498 aa AA seqDB search
MEYLLALDQGTSSSRAIVFNRAGQIVASAQQEFPQHFPQPGWVEHDPFDIWNSQLATCRA
ALEQAKLTAADMAALGITNQRETTMVWERATGKPIFNAIVWQDRRTEAICERLRAEGLED
EVRKRTGLIIDPYFSATKLRWILDHVDGARERAARGELAFGTIDSWLVWQLTRGRLHVTD
VSNASRTMLWNIHTGEWDADLMRALDIHPSLLPEVHPSAYQFGQTDADWLGASLTIGGIA
GDQQSALFGQACFKPGMAKNTYGTGCFMLLNTGDKAVQSHNGLISTAACQSGTKRSYALE
GSVFVGGAVVQWLRDGLRAIQRSADVEGLAASVPDSGGVVFVPSFTGLGAPYWDPTAQGA
IVGLSRGTTIGHIARAALESIAFQSTALLQAMTRDAVSTISELRVDGGASANNLLLQFQA
DLLGIPVVRPEIIETTALGAAYLAGIATGFYRDEAEVAQQWRASRTFHPVISRDEAAHRI
AQWEMAVAQVRLPTARAH
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaatacctcctcgcgctcgaccagggcacgtccagctcacgcgccatcgtcttcaac
cgcgccggccagatcgtcgccagtgcccagcaggagtttccgcagcatttcccgcagccc
ggctgggtcgagcatgacccgttcgacatctggaacagccagctcgccacctgccgcgcc
gcactcgaacaagccaagctgaccgctgccgacatggccgcgcttggcatcaccaaccaa
cgcgaaaccaccatggtgtgggagcgcgccactggcaaaccgatcttcaacgccatcgtc
tggcaggaccgccgcaccgaagccatctgcgaacgcctgcgcgccgagggcctggaagac
gaggtgcgcaagcgcaccggcctgatcatcgatccgtatttttcggccaccaagctgcgc
tggattctcgaccacgtggacggcgcccgcgagcgcgcggcgcgtggcgaactcgccttc
ggcaccatcgacagctggctcgtgtggcagctcacgcgcggccgcctccatgtgaccgac
gtgtcgaacgcttcccgcacgatgctgtggaacatccacacgggcgaatgggatgcggac
ctgatgcgcgcgctggacattcacccgagcctgttgcccgaggtgcatccgtctgcgtac
cagtttgggcagaccgatgcggactggctcggcgcttcgctcaccatcggcggcattgcc
ggcgaccagcaatcggcgctcttcggccaggcctgcttcaagccgggcatggccaagaac
acctacggcaccggctgtttcatgttgctcaacacgggcgacaaagcggtccagtcgcac
aacggcctcatcagcacggcggcatgccagagcggcacgaagcgcagctatgcgctcgaa
ggcagtgtgtttgtgggcggcgcggtcgtgcagtggctgcgcgacggcctgcgcgcgatc
cagcggtccgccgacgtcgaagggctggccgcctcggtgcccgattccggaggtgtggtg
ttcgtgccgtcgttcacaggcctgggtgcgccgtactgggaccctaccgcacaaggcgcc
atcgtcggcctgtcacgcggcaccaccatcggccacatcgctcgtgcggcactcgaatcc
atcgccttccaaagcacggcactgctgcaggccatgacgcgcgatgccgtttccaccatc
tcggaactgcgcgtcgatggcggtgcctcggccaacaacctgctgctgcagttccaggca
gatttgctgggtattccggtggtgcgcccggagatcatcgagacgacggcgctcggcgcg
gcttacctggcgggcatcgcaaccggcttctatcgtgatgaagcggaagtcgcccagcaa
tggcgtgcctcgcgcacgttccacccggtcatcagccgcgacgaggcggcgcatcgcatc
gcccagtgggaaatggccgtcgcgcaggtccgcctgccgaccgcgcgtgctcactga

DBGET integrated database retrieval system