KEGG   Ralstonia pickettii 12D: Rpic12D_3331Help
Entry
Rpic12D_3331      CDS       T00925                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpic12D_3331
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Rpic12D_3331
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpic12D_3331
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Rpic12D_3331
Exosome [BR:rpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpic12D_3331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3513623..3515080)
Genome map
AA seq 485 aa AA seqDB search
MHNHTFTKYAAAAAAALAMAACGSDGTSTAGGATPDTTPPSATPAKNVVFFLGDGMGLTT
MTAARIYKVGEDGELTMDTLPETGFVRTFSNNAQVTDSAPSMSAYMTGVKMNNEVISMSP
DTMAYDAGGKDYLSGADSTCPSGNGKPVTTLLELMKAAGYGTGVVTTTRITHATPAATYS
HICHRDGENTIAAQLTPAGKGFNAALGDGVDVVFGGGRKHFQPTTAGGARTDGRDLIAEL
KAGGYRYASNKAEFDTLQATDGKVVGLFTSSHMSYDLDRDPSKEPSLGEMTNKAIDVLAA
KKKGFFLMVEGGRIDHALHETTARKALQDTVAFDSAIRGAIDKLNTIDPGLKNTLIVVTA
DHDHTLVLNGYAKRTGPTSDSNPGVLGLLKNYVTGANATDTGGNPFTIIGFGTGENRPAT
RGALTDAAVYDKNYHQEAVIPVAPGGETHGGTDVFIGARGLGAERFTGTLDNTEVFGLIK
QAVGL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaccatacattcacgaagtacgccgccgccgcggccgctgcactggccatggcc
gcgtgcggcagcgacggcacgtccaccgccggcggcgccacgccggataccaccccgccg
agcgccacgcccgccaagaacgtcgtgttcttcctgggcgacggcatgggcctgaccacc
atgaccgccgcgcgcatctacaaggtgggcgaagacggcgagctgaccatggacacgctg
ccggaaaccggcttcgtgcgcacgttctcgaacaacgcgcaggtgaccgactcggcgccg
tcgatgtcggcctacatgaccggcgtgaagatgaacaacgaggtcatctcgatgtcgccg
gacacgatggcctatgacgccggcggcaaggattacctctcgggcgccgacagcacctgc
ccgagcggcaacggcaagcccgtcacgactctgctcgaactgatgaaggcagcgggctac
gggacgggcgtggtcaccaccacgcgcatcacgcacgccacgccggccgccacgtattcg
cacatttgccatcgcgacggcgagaacaccatcgccgcgcaactcacgccggccggcaag
ggcttcaacgctgcgctgggcgatggtgtggacgtcgtcttcggcggcggccgcaagcac
ttccagccgaccacggcaggcggcgcacgcaccgatggccgcgacctgatcgccgaactc
aaggcgggcggctaccgctatgccagcaacaaggccgaattcgacacgctgcaagccacc
gacggcaaggtcgtcggcctgttcaccagcagccacatgtcgtacgacctggatcgtgat
ccgagcaaggagccgagcctgggcgagatgaccaacaaggccatcgacgtgctggccgcc
aagaagaagggcttcttcctgatggtggaaggcggccgcatcgaccacgcgctgcacgaa
accaccgcccgcaaggcactgcaggacacggtggcgttcgattccgccatccgcggcgcg
atcgacaagctcaacacgatcgacccgggcctgaagaacacgctgatcgtcgtgacggct
gaccacgaccacacgctggtgctcaacggctacgccaagcgcacgggcccgaccagcgac
agcaaccccggcgtgctgggcctgctgaagaactacgtgacgggcgccaacgccaccgac
acgggcggcaacccgttcacgatcatcggcttcggcacgggtgagaaccgcccggccacg
cgcggcgccctgaccgatgctgccgtgtacgacaagaactaccaccaggaagccgtgatc
ccggttgcaccgggcggcgaaacgcacggcggcaccgatgtcttcatcggcgcacgcggc
ctgggtgccgagcgctttaccggcacgttggacaacaccgaggtcttcggcctcatcaag
caggccgtgggcctgtaa

DBGET integrated database retrieval system